DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and ATG7

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_012041.1 Gene:ATG7 / 856576 SGDID:S000001214 Length:630 Species:Saccharomyces cerevisiae


Alignment Length:306 Identity:60/306 - (19%)
Similarity:116/306 - (37%) Gaps:68/306 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHAIDELQAIIADLKTELETEPKSSGGVAS-NSRLARDRID--------RMSAEVVDSNPYSRLM 57
            |.|::...|.|....:....:.|.||...: ..:||...:|        :::.:.||.|     :
Yeast   247 SFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLSSLLDPLKIADQSVDLN-----L 306

  Fly    58 ALQRMNIVKD--YERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELAN-MNRLFFT 119
            .|.:..|:.|  .:.|:...|.::|.|.:|...:..|...|:.|:...|...|..:| :.:..:.
Yeast   307 KLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNGTVSYSNPVRQALYN 371

  Fly   120 PDQAGLSKVAAAAATLSFINPDVEIETHNYNITTV-----------ENFDRFLDTISQGGRIAGQ 173
            .:..|..|...|||:|..|.|.::......:|..:           ::|||....|.:.      
Yeast   372 FEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNEEAQHKDFDRLRALIKEH------ 430

  Fly   174 PVDLVLSCVDNFEARMAINAACNERNLNWFESGVSE-------NAVSGHIQFI--RPGD------ 223
              |::...||:.|:|             |..|.:|.       ||..|...::  |.|:      
Yeast   431 --DIIFLLVDSRESR-------------WLPSLLSNIENKTVINAALGFDSYLVMRHGNRDEQSS 480

  Fly   224 --TACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFLVQ 267
              ..|:.|...:...:::.::||  :.:|..:.|....:.:...|:
Yeast   481 KQLGCYFCHDVVAPTDSLTDRTL--DQMCTVTRPGVAMMASSLAVE 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 47/247 (19%)
ThiF 53..310 CDD:279270 47/246 (19%)
ATG7NP_012041.1 E1_like_apg7 9..628 CDD:273590 60/306 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.