DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and AOS1

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_015506.1 Gene:AOS1 / 856310 SGDID:S000006384 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:288 Identity:54/288 - (18%)
Similarity:101/288 - (35%) Gaps:84/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILF 103
            :::::|.:.:..  |.|.:.|..|..   ...:|...|.::.:|.:||.....:...|||.|.:.
Yeast     4 KVEKLSEDEIAL--YDRQIRLWGMTA---QANMRSAKVLLINLGAIGSEITKSIVLSGIGHLTIL 63

  Fly   104 DYDKVELANMNRLFFT-PDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLDTISQG 167
            |...|...::...||. .:..|..|:.|....:..:||.:|:           |||:  ..:.:.
Yeast    64 DGHMVTEEDLGSQFFIGSEDVGQWKIDATKERIQDLNPRIEL-----------NFDK--QDLQEK 115

  Fly   168 GRIAGQPVDLVLSCVDNFEARMAINAACNERNLNWFESG---------------VSENAVSGHIQ 217
            .....|..|||::.....:..:.||....:.|:..:.:|               :||:.   .:|
Yeast   116 DEEFFQQFDLVVATEMQIDEAIKINTLTRKLNIPLYVAGSNGLFAYVFIDLIEFISEDE---KLQ 177

  Fly   218 FIRPGDTACFA----------------------------CAPPL-------VVAENIDEKTLKRE 247
            .:||......:                            |..||       .:.|.:.::.||| 
Yeast   178 SVRPTTVGPISSNRSIIEVTTRKDEEDEKKTYERIKTKNCYRPLNEVLSTATLKEKMTQRQLKR- 241

  Fly   248 GVCAASLPTTMGITAGFLVQNALKYLLN 275
              ..:.||.|:.:         |:|.||
Yeast   242 --VTSILPLTLSL---------LQYGLN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 53/275 (19%)
ThiF 53..310 CDD:279270 53/274 (19%)
AOS1NP_015506.1 Aos1_SUMO 13..345 CDD:238769 53/279 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.