DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Uba7

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_076227.1 Gene:Uba7 / 74153 MGIID:1349462 Length:977 Species:Mus musculus


Alignment Length:420 Identity:80/420 - (19%)
Similarity:132/420 - (31%) Gaps:179/420 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VDSNPYSR---LMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVE 109
            :|...|||   ::.|..|      :||:...|.:.|:.|:|:..|..|...|:|.|.|.|.....
Mouse     1 MDEELYSRQLYVLGLPAM------QRIQEAKVLLCGLQGLGAEVAKNLVLTGVGSLTLHDPHPTC 59

  Fly   110 LANM-NRLFFTPDQAGLSKVAAAAATLSFINPDVEIETHNYNIT--TVENFD------------- 158
            .|:: .:.|.:.:..|.::..|:.|.|:.:|..|:|..|:.:||  .::.|.             
Mouse    60 WADLAAQCFLSEESLGRNRAEASQAQLAQLNEAVQISVHSGDITEDLLQGFQVVVLTDSKLEDQL 124

  Fly   159 -----------RFLDTISQG--GRI---------------------AGQPV-------------- 175
                       |||...::|  ||:                     |.|.:              
Mouse   125 KVGPLCHKHGVRFLMAETRGLVGRLFCDFGEDFTVLDPTEVEPMTAAIQDISQGFPGIVTLRGDT 189

  Fly   176 --------DLVLSCVDNFEARMAINAACNERNLNWFESGVSENAVSGHIQFIRPGDTACF----- 227
                    |||:  ..:.|..:.:| :|:.:::...:.|..|           .|||..|     
Mouse   190 KRHSFHDGDLVI--FSDIEGMVELN-SCSPQSVRVQKDGSLE-----------IGDTTTFSRYLR 240

  Fly   228 --------------------ACAPPLVVAEN---------------------------------- 238
                                |...|.|||:|                                  
Mouse   241 GGVVTEVKRPKTVRHKPLDIALLQPHVVAQNTQEVQRAHCLHQAFHVLHKFQQLHGRLPKPWDPD 305

  Fly   239 ----------------------IDEKTLKREGVCAA-SLPTTMGITAGFLVQNALKYL-LNFGEV 279
                                  :||..|:...:.:| :|.....|..|...|..||.: ..|..:
Mouse   306 DAETVVELAQDLEPLKGTEEESLDEALLRTIALSSAGTLSPMAAIMGGVAAQEVLKAISRKFMPL 370

  Fly   280 SDYLGYNALSDFFPKMTLKPNPQ-CDDRNC 308
            ..:|.::||.......||.|:|: |..|||
Mouse   371 DQWLYFDALECLPEDETLLPSPEDCQPRNC 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 71/402 (18%)
ThiF 53..310 CDD:279270 79/415 (19%)
Uba7NP_076227.1 Ube1 1..961 CDD:273603 80/420 (19%)
Ube1_repeat1 5..386 CDD:238768 71/400 (18%)
E1_4HB 254..317 CDD:292809 6/62 (10%)
E1_enzyme_family 421..932 CDD:304554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.