DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and nae1

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_956793.1 Gene:nae1 / 573336 ZFINID:ZDB-GENE-040426-1552 Length:533 Species:Danio rerio


Alignment Length:145 Identity:33/145 - (22%)
Similarity:53/145 - (36%) Gaps:36/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TEPKSSGGVASNSRLARDRIDRMSAEVVDSNPYSRLMALQRMNIVKDY--ERIRYKAVAIVGVGG 83
            |:||:|         ...|.||                  ::.:..|:  |.:....|.::....
Zfish     2 TDPKTS---------KEQRYDR------------------QLRLWGDHGQEALENAHVCLINATA 39

  Fly    84 VGSVTADMLTRCGIGKLILFDYDKVELANMNRLFFTPDQA-GLSKVAAAAATLSFINPDVEIETH 147
            .|:.....|...|||...:.|..||...::...||....| |.::..||...|..:|.||   :.
Zfish    40 SGTEILKNLVLPGIGAFTIVDGHKVSGEDVGNNFFLSSSAIGKNRAQAATELLQELNSDV---SG 101

  Fly   148 NYNITTVENFDRFLD 162
            |:   ..|:.|:.||
Zfish   102 NF---VEESPDKLLD 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 26/114 (23%)
ThiF 53..310 CDD:279270 26/113 (23%)
nae1NP_956793.1 ThiF 6..>164 CDD:223552 30/141 (21%)
APPBP1_RUB 10..531 CDD:238770 29/128 (23%)
Interaction with uba3. /evidence=ECO:0000250 330..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.