DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and UBA6

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_060697.4 Gene:UBA6 / 55236 HGNCID:25581 Length:1052 Species:Homo sapiens


Alignment Length:481 Identity:107/481 - (22%)
Similarity:158/481 - (32%) Gaps:160/481 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGI----- 97
            ||.|.:.|.:.|    :....||.:||.            :||.|.:|..........|:     
Human   441 DRYDALRACIGD----TLCQKLQNLNIF------------LVGCGAIGCEMLKNFALLGVGTSKE 489

  Fly    98 -GKLILFDYDKVELANMNRLF-FTPDQAGLSK-VAAAAATLSFINPDVEIETH-NYNITTVENF- 157
             |.:.:.|.|.:|.:|:||.| |.|......| ..||.|||. ||..::|:.| |....|.|.. 
Human   490 KGMITVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAADATLK-INSQIKIDAHLNKVCPTTETIY 553

  Fly   158 -DRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAAC--NERNLNWFESGVSENAVSGHIQFI 219
             |.|.           ...|::::.:||.|||..:::.|  |.|.|  .:||..  ...||.:.|
Human   554 NDEFY-----------TKQDVIITALDNVEARRYVDSRCLANLRPL--LDSGTM--GTKGHTEVI 603

  Fly   220 RPGDTACFAC--APPLVVAENIDEKTLKREGVCAASLPTTMGIT---------AGFLVQNAL--K 271
            .|..|..:..  .||   .|.|...|||       |.|..:..|         :.|..:.:|  |
Human   604 VPHLTESYNSHRDPP---EEEIPFCTLK-------SFPAAIEHTIQWARDKFESSFSHKPSLFNK 658

  Fly   272 YLLNFGEVSDYL-----GYNALSDFFPKMTLKPNP----QCDDRNCLVRQKEFQAR--------- 318
            :...:....:.|     |::....|.....|...|    ||.:...|..:|.|..:         
Human   659 FWQTYSSAEEVLQKIQSGHSLEGCFQVIKLLSRRPRNWSQCVELARLKFEKYFNHKALQLLHCFP 723

  Fly   319 ------------------PKPVLIEEKAVSEEPLHAT----------NEWGIELVAED------- 348
                              |.|:    |....||||.:          ..:.|....||       
Human   724 LDIRLKDGSLFWQSPKRPPSPI----KFDLNEPLHLSFLQNAAKLYATVYCIPFAEEDLSADALL 784

  Fly   349 -------------------APESNTTPAETPVMGEGLRLAYEAPEKSSETSEETVS----AATAD 390
                               ..|:...|...|:..|..|.|....||:..::|.|.|    |..:.
Human   785 NILSEVKIQEFKPSNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKSDLQMAVLSF 849

  Fly   391 E------------TSLEDLMAQMKSM 404
            |            |:..:|.|:|.|:
Human   850 EKDDDHNGHIDFITAASNLRAKMYSI 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 67/275 (24%)
ThiF 53..310 CDD:279270 71/291 (24%)
UBA6NP_060697.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Ube1 38..1046 CDD:273603 107/481 (22%)
Ube1_repeat1 43..432 CDD:238768
E1_4HB 299..361 CDD:292809
Ube1_repeat2 462..1005 CDD:238767 100/456 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.