DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Aos1

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster


Alignment Length:363 Identity:73/363 - (20%)
Similarity:120/363 - (33%) Gaps:104/363 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLFFTP-DQAGLSKV 128
            ::..:|:|...:.|.|:.|:|:.....:...|:..:.|.|...|...:....|..| :....::.
  Fly    31 LESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEEDFCSQFLVPRESLNTNRA 95

  Fly   129 AAAAATLSFINPDVEIETHNYNI--TTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAI 191
            .|:......:||.|:|......:  .|.|.|.:|               |:|:......|..:.|
  Fly    96 EASLTRARALNPMVDISADREPLKEKTSEFFGQF---------------DVVVVNGATNEELLRI 145

  Fly   192 NAACNERNLNWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENI--------DEKTLKREG 248
            :..|.:..:.:..:.     |.|...|.       ||........|::        .||..|.|.
  Fly   146 DTICRDLGVKFIATD-----VWGTFGFY-------FASLQKHSYVEDVIKHKVVANSEKKKKYET 198

  Fly   249 VCAASLPTTMGITAGFLVQNALKYLLNFGEVSDYLGYNALSDF---FPKMTLKPNPQCDDRN--- 307
            |   |:||...:                    ||.||:|..||   .|....|..     ||   
  Fly   199 V---SIPTQRDV--------------------DYPGYSAWLDFDVTEPSYLRKLK-----RNGPG 235

  Fly   308 ---CLVRQKEFQARPKPVLIEEKAVSEEPLHATNEWGIELVA----EDAPESNTTPAETPVMGE- 364
               ..|.|| |:...|          .:|.:.|.|..:||:.    |..|.|        ::|: 
  Fly   236 VLLLSVLQK-FRTTHK----------RDPSYKTREADLELLRGIRDELLPNS--------ILGDE 281

  Fly   365 --GLRLAYEAPEKS---SETSEETVSAATADETSLEDL 397
              ||..|..:|..:   ...::|.:...|..|....:|
  Fly   282 ALGLIFAQISPAVAVVGGVVAQEVIKVVTKLEAPHRNL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 48/245 (20%)
ThiF 53..310 CDD:279270 51/264 (19%)
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 31/167 (19%)
ThiF 22..>167 CDD:279270 28/155 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446836
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.