DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and uba3

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_998632.1 Gene:uba3 / 406776 ZFINID:ZDB-GENE-040426-2825 Length:462 Species:Danio rerio


Alignment Length:340 Identity:73/340 - (21%)
Similarity:122/340 - (35%) Gaps:108/340 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAAATLSFIN 139
            :.::|.||:|......|...|...:.:.|.|.::::|:||.| |.|...|..|...||   .|:|
Zfish    71 ILVIGAGGLGCELLKDLALSGFRHIHVVDMDTIDVSNLNRQFLFRPKDVGRPKAEVAA---DFVN 132

  Fly   140 ---PDVEIETHNYNITTV-ENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNL 200
               |...:..|...|..: |.|.|              ...:|:..:|:..||..:|...  .:|
Zfish   133 DRVPGCSVVPHFKKIQDLDETFYR--------------QFHIVVCGLDSVIARRWMNGML--LSL 181

  Fly   201 NWFESGVSE------------NAVSGHIQFIRPGDTACFACA----PPLVVAENIDEKTLKREGV 249
            ..:|.||.:            ....|:.:.|.||.|||..|.    ||.:   |....|:     
Zfish   182 LIYEDGVLDPSSIIPLIDGGTEGFKGNARVILPGMTACIDCTLELYPPQI---NFPMCTI----- 238

  Fly   250 CAASLPTTMGITAGFLVQNALKYLLNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRNCLVRQKE 314
              ||:|.        |.::.::|:                    :|.|.|           ::|.
Zfish   239 --ASMPR--------LPEHCVEYV--------------------RMLLWP-----------KEKP 262

  Fly   315 FQARPKPVLIEEKAVSEEPLHATNEWGIELVAEDAPESNTTPAETPVMGEGLRLAYEAPEK---S 376
            |   ...|:::    .::|.|.  :|..:...|.|.|.|.|       |...||.....::   :
Zfish   263 F---GDGVVLD----GDDPKHI--QWVYQKSLERAAEFNIT-------GVTYRLTQGVVKRIIPA 311

  Fly   377 SETSEETVSAATADE 391
            ..::...::||.|.|
Zfish   312 VASTNAVIAAACATE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 53/241 (22%)
ThiF 53..310 CDD:279270 55/254 (22%)
uba3NP_998632.1 Interaction with ube2m N-terminus. /evidence=ECO:0000250 52..69
ThiF 66..>240 CDD:279270 47/197 (24%)
Uba3_RUB 70..367 CDD:238765 73/340 (21%)
Interaction with ube2m N-terminus. /evidence=ECO:0000250 156..160 1/17 (6%)
Interaction with ube2m N-terminus. /evidence=ECO:0000250 191..216 3/24 (13%)
Interaction with nedd8. /evidence=ECO:0000250 226..228 0/1 (0%)
Interaction with nae1. /evidence=ECO:0000250 241..247 2/13 (15%)
Interaction with nae1. /evidence=ECO:0000250 291..294 1/2 (50%)
Interaction with ube2m N-terminus. /evidence=ECO:0000250 330..337
Interaction with nedd8. /evidence=ECO:0000250 351..356
Interaction with ube2m core domain. /evidence=ECO:0000250 367..462
E2_bind 375..460 CDD:285976
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.