DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and uba1

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_998227.1 Gene:uba1 / 406335 ZFINID:ZDB-GENE-040426-2009 Length:1058 Species:Danio rerio


Alignment Length:478 Identity:101/478 - (21%)
Similarity:160/478 - (33%) Gaps:172/478 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TELETEPKSSGGVASNSRLARDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGV 81
            ||.|..|::.            |.|...|  |..:....|:|.||              ..:||.
Zfish   441 TEEECAPRNC------------RYDGQIA--VFGSKLQELLAKQR--------------YFLVGA 477

  Fly    82 GGVGSVT----ADMLTRCGIGKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAAATLSFINPD 141
            |.:|...    |.|....|.|::|:.|.|.:|.:|:||.| |.|......|...|||.:..:||.
Zfish   478 GAIGCELLKNFAMMGLASGEGEVIVTDMDTIEKSNLNRQFLFRPWDVTKMKSETAAAAVKQMNPS 542

  Fly   142 VEIETHNYNI---TTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLNWF 203
            |.|..|...:   |.....|.|.:.:           |.|.:.:||.:|||.::..|........
Zfish   543 VRITGHQNRVGPDTEKVYDDDFFECL-----------DGVANALDNVDARMYMDRRCVYYRKPLL 596

  Fly   204 ESGVSENAVSGHIQFIRPGDTACFACA--PPLVVAENIDEKTLKREGVCA-ASLPTTMGITAGFL 265
            |||..  ...|::|.:.|..|..::.:  ||        ||::.   :|. .:.|..:..|..:.
Zfish   597 ESGTL--GTKGNVQVVIPFITESYSSSQDPP--------EKSIP---ICTLKNFPNAIEHTLQWA 648

  Fly   266 -----------VQNALKYLLNFGEVSDYLGYNALSDFFPKMTLK-PNPQCDDRNCLVRQKEFQAR 318
                       .:|||:||.:              ..|.:.||| |.                |:
Zfish   649 RDEFEGLFKQPAENALQYLTD--------------SKFMERTLKLPG----------------AQ 683

  Fly   319 PKPVL--IEEKAVSEEPLH-------ATNEW------GIELVAEDAPESNTTPAETPVMGEGLR- 367
            |..|:  :.:..|::.|.:       |.|.|      .|..:..:.|....|.:..|......| 
Zfish   684 PLEVVESVYKSLVTDRPRNWDDCVTWARNHWQCQYNNNIRQLLHNFPPDQLTSSGAPFWSGPKRC 748

  Fly   368 -------------------------LAYEAP---EKSSET----------------------SEE 382
                                     |:|..|   ::|:.|                      .:|
Zfish   749 PHPLEFSTNNDLHMDYILAAANLYALSYGLPSCNDRSALTKLLQDIKVPEFTPKSGVKIHVSDQE 813

  Fly   383 TVSA-ATADETSLEDLMAQMKSM 404
            ..|| |:.|::.||:|...:.|:
Zfish   814 LQSANASVDDSRLEELKTLLPSL 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 62/266 (23%)
ThiF 53..310 CDD:279270 66/279 (24%)
uba1NP_998227.1 Ube1 49..1055 CDD:273603 101/478 (21%)
Ube1_repeat1 54..436 CDD:238768
E1_4HB 303..366 CDD:292809
Ube1_repeat2 471..1011 CDD:238767 90/434 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.