DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and mocs3

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_956421.1 Gene:mocs3 / 393095 ZFINID:ZDB-GENE-040426-782 Length:459 Species:Danio rerio


Alignment Length:500 Identity:113/500 - (22%)
Similarity:173/500 - (34%) Gaps:163/500 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ELQAIIADLKTELE-------TEPKSSGGVAS------NSRLARDRIDRMSAEVVDSNPYSRLMA 58
            |.:..:|.||.:|:       |.|:....|.|      |:.|..|.|.|          |||.:.
Zfish    14 EREREVATLKKKLDQIEKGNSTLPELQEKVTSLSPLRLNTSLNNDDIMR----------YSRQLL 68

  Fly    59 LQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNR-LFFTPDQ 122
            |..:. ||....|...:|.:||.||:|...|..|...|||:|.|.|||.|||:|::| :..|...
Zfish    69 LPELG-VKGQIAISNISVLVVGCGGLGCPLAQYLAAAGIGRLGLLDYDVVELSNLHRQVLHTELT 132

  Fly   123 AGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEA 187
            .|..|..:||..:|.:|..|:...::..::. ||..:.:           |..|:|..|.||...
Zfish   133 QGQPKALSAAQAISRMNSTVQCVPYHLQLSR-ENAIQLI-----------QQYDIVADCSDNVPT 185

  Fly   188 RMAINAAC--NERNLNWFESGVSENA--VSGHIQFIRPGDTACFAC-----APPLVVAENIDEKT 243
            |..:|.||  ..|.|      ||.:|  :.|.:.........|:.|     .||..|....|...
Zfish   186 RYLVNDACVLTSRPL------VSASALRMEGQLTVYNYRGGPCYRCLYPIPPPPETVTNCSDGGV 244

  Fly   244 LKREGVCAASLPTTMG---------ITAGFLVQNALKYLLNFGE--------------------- 278
            |   ||    :|..||         |.:|.....|.:.|:..||                     
Zfish   245 L---GV----VPGIMGCLQALEVLKIASGQECSFAQQLLMFDGEQTRFRSIRLRSRQKECVVCGE 302

  Fly   279 -----------------------------------VSDYLGYNALSDFFPKMTLKPNPQCDDRNC 308
                                               |.||.|  .|....|.:.|...|:.:...|
Zfish   303 KPTITELQDYEHFCGSAATDKCRRLHLLSREQRVSVQDYKG--ILDHSTPHLLLDVRPKVEVDIC 365

  Fly   309 LVRQKEF-------QARPKPVLIEEKAVSEEPLHATNEWGIELVAEDAPESNTTPAETPV---MG 363
            .:.....       ..:|:.:.:.::|:|:...|..|:               :|.:..|   :|
Zfish   366 RLSNSLHIPLASLEDKKPEHITLLKEAISDLQEHLNNQ---------------SPVQVFVVCKLG 415

  Fly   364 EGLRLAYEAPEKSSETSEETVSAATADETSLED----LMAQMKSM 404
            ...:.|.:..||        :|.|..:..:::|    |||..|.:
Zfish   416 NDSQKAVQLLEK--------MSGAEVEAMTVKDIGGGLMAWAKKI 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 78/319 (24%)
ThiF 53..310 CDD:279270 81/331 (24%)
mocs3NP_956421.1 PRK07411 46..459 CDD:180967 104/467 (22%)
ThiF_MoeB_HesA_family 62..290 CDD:238386 73/263 (28%)
RHOD_ThiF 327..459 CDD:238784 27/150 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.