DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Atg7

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster


Alignment Length:282 Identity:59/282 - (20%)
Similarity:100/282 - (35%) Gaps:48/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EPKSSGGVASNSRLARDRID--RMSAEVVDSNPYSRLMALQRMNIVKD--YERIRYKAVAIVGVG 82
            |...:|.:.......||.:|  :::...|:.|     :.|.:..:|.|  .|.|......:.|.|
  Fly   289 ELNKNGKMGPRMVCMRDSMDPAKLAENSVNLN-----LKLMKWRLVPDLNLEIISQTKCLLFGAG 348

  Fly    83 GVGSVTADMLTRCGIGKLILFDYDKVELANMNR--LFFTPDQAGLSKVAA--AAATLSFINPDVE 143
            .:|...|..|...|...:.|.|..||..:|..|  |:...|....:::.|  ||..|..|||..|
  Fly   349 TLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRMKATTAAQRLKEINPSAE 413

  Fly   144 ---------IETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEAR----------- 188
                     :..|....:.:......|..|.:    ..|..|::....|:.|:|           
  Fly   414 TAGYVLEIPMPGHTIGESLLAQTKEHLKVIEK----LVQDHDVIFLLTDSRESRWLPTLLGAAKE 474

  Fly   189 -MAINAACN-------ERNLNWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDEKTLK 245
             :.||||..       .......|:|.....:.| ::.|......|:.|........::.::||.
  Fly   475 KIVINAALGFDSYLVMRHGTTRKEAGDDGQEIEG-LKCINGDQLGCYFCNDVTAPGNSLKDRTLD 538

  Fly   246 REGVCAASLPTTMGITAGFLVQ 267
            ::  |..:.|....|.|.:.|:
  Fly   539 QQ--CTVTRPGVSNIAASYAVE 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 52/250 (21%)
ThiF 53..310 CDD:279270 52/249 (21%)
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029 2/13 (15%)
E1_like_apg7 11..682 CDD:273590 59/282 (21%)
Apg7 341..658 CDD:238763 47/225 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446842
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.