DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Uba4

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster


Alignment Length:354 Identity:91/354 - (25%)
Similarity:144/354 - (40%) Gaps:74/354 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IDELQAIIADLKTELETEPKSSGGVASNSRLARDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYE 69
            :|.|.:.....:.|:......|..||.:::|..|.|.|          |||.:.|.... |:...
  Fly    34 LDSLFSFATRPEQEVVGNDLESPDVAVHTKLTNDDIAR----------YSRQLILPDFG-VQGQL 87

  Fly    70 RIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNR-LFFTPDQAGLSKVAAAAA 133
            :::..:|.|||:||:|...|..|...|.|.|.|.|||:||.:|.:| :..:.|:.|:||..:|..
  Fly    88 KLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARI 152

  Fly   134 TLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNER 198
            .|..:||..||:.|:          |.|...:....|.|  .|:||.|.||...|..::.||   
  Fly   153 ALLELNPHCEIQCHS----------RMLYPHNAMHIIRG--YDVVLDCTDNVPTRYLLSDAC--- 202

  Fly   199 NLNWFESGVSENA--VSGHIQFIRPGDTACFAC----APPLVVAENIDEKTLKREGVCAASLPTT 257
             :...:..||.:|  :.|.:......:..|:.|    .||.....|..:     .||..|    .
  Fly   203 -VMLSKPLVSGSALKMDGQLTVYNYANGPCYRCIFPVPPPPEAVTNCGD-----GGVLGA----V 257

  Fly   258 MGITAGFLVQNALKYLLNFGEV--SDYLGYNALSDFFPKMTLKPNPQCDDRNCLVRQKEFQARP- 319
            .|.........|:|.::..|:|  ...|.::..|..|             ||..:|.|    || 
  Fly   258 TGTIGAMQALEAIKVIVGMGDVLAGRLLIFDGGSGVF-------------RNIRIRSK----RPN 305

  Fly   320 ------KPVLIEEKAVSEE---PLHATNE 339
                  :|::.|  .::.|   .:|||::
  Fly   306 CHMCSAQPLITE--LINYEMFCGMHATDK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 69/253 (27%)
ThiF 53..310 CDD:279270 71/265 (27%)
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 87/332 (26%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 72/276 (26%)
RHOD_ThiF 336..453 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446837
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.