DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Uba1

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001014102.1 Gene:Uba1 / 314432 RGDID:1359327 Length:1058 Species:Rattus norvegicus


Alignment Length:473 Identity:91/473 - (19%)
Similarity:162/473 - (34%) Gaps:154/473 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LETEPKSSGGVASNSRLARDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVGG 83
            ||..|:....:..:..|.|            .|.|...:|:...::   .|::..:...:||.|.
  Rat   429 LECLPEDKEALTEDKCLPR------------QNRYDGQVAVFGSDL---QEKLGKQKYFLVGAGA 478

  Fly    84 VGSVTADMLTRCGI-----GKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAAATLSFINPDV 142
            :|..........|:     |::::.|.|.:|.:|:||.| |.|......|...|||.:..:||.:
  Rat   479 IGCELLKNFAMIGLGCGEGGEVVVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPYI 543

  Fly   143 EIETHNYNI----TTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLNWF 203
            ::.:|...:    ..:.:.|.|            |.:|.|.:.:||.:|||.::..|........
  Rat   544 QVTSHQNRVGPDTERIYDDDFF------------QNLDGVANALDNVDARMYMDRRCVYYRKPLL 596

  Fly   204 ESGVSENAVSGHIQFIRPGDTACFACA--PPLVVAENIDEKTLKREGVCA-ASLPTTMGITAGFL 265
            |||..  ...|::|.:.|..|..::.:  ||        ||::.   :|. .:.|          
  Rat   597 ESGTL--GTKGNVQVVIPFLTESYSSSQDPP--------EKSIP---ICTLKNFP---------- 638

  Fly   266 VQNALKYLLNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRNCLVRQKEFQAR--------PKPV 322
              ||:::.|.:..           |.|..:..:|   .::.|..:...:|..|        |..|
  Rat   639 --NAIEHTLQWAR-----------DEFEGLFKQP---AENVNQYLTDSKFVERTLRLAGTQPLEV 687

  Fly   323 L--IEEKAVSEEP-------LHATNEW------GIELVAEDAPESNTTPAETPV----------- 361
            |  ::...|.:.|       ..|.:.|      .|..:..:.|....|.:..|.           
  Rat   688 LEAVQRSLVLQRPQTWGDCVTWACHHWHTQYCNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPL 752

  Fly   362 ---MGEGLRLAY------------------------------EAPE-------KSSETSEETVSA 386
               :...|.|.|                              :.||       |...:.:|..||
  Rat   753 TFDVNNTLHLDYVMAAANLFAQTYGLTGSQDRAAVASLLQSVQVPEFTPKSGVKIHVSDQELQSA 817

  Fly   387 -ATADETSLEDLMAQMKS 403
             |:.|::.||:|.|.:.|
  Rat   818 NASVDDSRLEELKATLPS 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 54/257 (21%)
ThiF 53..310 CDD:279270 56/269 (21%)
Uba1NP_001014102.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Ube1 49..1055 CDD:273603 91/473 (19%)
2 approximate repeats. /evidence=ECO:0000255 63..611 47/210 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.