DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Atg7

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_008761461.1 Gene:Atg7 / 312647 RGDID:1304817 Length:703 Species:Rattus norvegicus


Alignment Length:355 Identity:78/355 - (21%)
Similarity:124/355 - (34%) Gaps:68/355 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHAIDELQAIIADLK-TELETEP----------KSSGGVASNSRLARDRID--RMSAEVVDSNP 52
            |..|.|...:||.::| .|:...|          ...||:..........:|  |::...||.| 
  Rat   269 MQGARDVTHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSGCMDPKRLAESSVDLN- 332

  Fly    53 YSRLMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNR-- 115
             .:||. .|:....|.:::......::|.|.:|...|..|...|:..:...|..|:..:|..|  
  Rat   333 -LKLMC-WRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHVTFVDNAKISYSNPVRQP 395

  Fly   116 LFFTPD--QAGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLD-TISQGGRIAGQ---- 173
            |:...|  ..|..|..|||..|..|.|.|.....|.:|....:...|.| |:.|..|...|    
  Rat   396 LYEFEDCLGGGKPKALAAAERLQKIFPGVNASGFNMSIPMPGHPVNFSDVTMEQARRDVEQLEEL 460

  Fly   174 --PVDLVLSCVDNFEAR------------MAINAACNERNLNWFESGVSENAVSG-------HIQ 217
              ..|::...:|..|:|            :.||||...........|:.:....|       |: 
  Rat   461 IDSHDVIFLLMDTRESRWLPTVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHL- 524

  Fly   218 FIRPGD-------------TACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFLVQNA 269
             :.|.|             ..|:.|...:...::..::||.::  |..|.| .:.:.||.|....
  Rat   525 -VAPADLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQ--CTVSRP-GLAVIAGALAVEL 585

  Fly   270 LKYLLNFGEVSDYLGYNALSDFFPKMTLKP 299
            :..:|...|.    ||...|....:|...|
  Rat   586 MVSVLQHPEG----GYAIASSSDDRMNEPP 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 62/287 (22%)
ThiF 53..310 CDD:279270 63/290 (22%)
Atg7XP_008761461.1 ATG7_N 9..316 CDD:293029 10/46 (22%)
E1_like_apg7 11..688 CDD:273590 78/355 (22%)
Apg7 353..677 CDD:238763 59/268 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.