DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Mocs3

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001101274.1 Gene:Mocs3 / 311655 RGDID:1307044 Length:458 Species:Rattus norvegicus


Alignment Length:425 Identity:105/425 - (24%)
Similarity:162/425 - (38%) Gaps:88/425 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DELQAIIADLKTELETEPKSSGGV-----ASNSRLARDRIDRMSAEVVDSNPYSRLMALQRMNIV 65
            :||.::...|...|..||:....:     .|.:.|:||.|.|          |||.:.|..:. |
  Rat    19 EELASLKQRLAAALAVEPEPERPIPVMPLPSRAALSRDEILR----------YSRQLLLPELG-V 72

  Fly    66 KDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNR-LFFTPDQAGLSKVA 129
            :...|:...:|.:||.||:|...|..|...|:|:|.|.|:|.||.:|:.| :.....|||.:|..
  Rat    73 RGQLRLAAASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDHDVVETSNLARQVLHGEAQAGHAKAW 137

  Fly   130 AAAATLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAA 194
            :|||.|..:|..||...:...::.....|     :.:|       .|:|..|.||...|..:|.|
  Rat   138 SAAAALRRLNSAVEYVPYARALSEAWALD-----LVRG-------YDVVADCSDNVPTRYLVNDA 190

  Fly   195 C--NERNLNWFESGVSENAV--SGHIQFIRPGDTACFACA----PPLVVAENIDEKTLKREGVCA 251
            |  ..|.|      ||.:|:  .|.:......|..|:.|.    ||.....|           ||
  Rat   191 CVLAGRPL------VSASALRFEGQMTVYHYDDGPCYRCVFPRPPPAETVTN-----------CA 238

  Fly   252 ASLPTTMGITAGFL--VQ--NALKYLLNFGEVSDYLG----YNALSDFFPKMTL-KPNPQC---- 303
            ..  ..:|:..|.|  ||  ..||.....|  :.|.|    ::.|...|.::.| :..|.|    
  Rat   239 DG--GVLGVVPGVLGCVQALEVLKIAAGLG--TTYSGSMLLFDGLGGHFRRIRLRRRRPDCVVCG 299

  Fly   304 --DDRNCLVRQKEF-------QARPKPVLIEEKAVSEEPLHATNEWGIELVAEDA-PESNTTPAE 358
              ....||...:.|       :.|...:|..|:.:|........:.|:..|..|. |:     .|
  Rat   300 QQPTVTCLKNYEAFCGSSATDKCRSLKLLSPEERISVTDYKRLLDSGVPHVLLDVRPQ-----VE 359

  Fly   359 TPV--MGEGLRLAYEAPEKSSETSEETVSAATADE 391
            ..:  :...|.:.....|:....|.:.:.||..:|
  Rat   360 VDICRLQHSLHIPLSLLERRDADSLKLLGAALQEE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 72/261 (28%)
ThiF 53..310 CDD:279270 76/280 (27%)
Mocs3NP_001101274.1 PRK07411 53..458 CDD:180967 98/391 (25%)
ThiF_MoeB_HesA_family 60..283 CDD:238386 72/266 (27%)
RHOD_ThiF 325..458 CDD:238784 14/75 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.