DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Uba2

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001094049.1 Gene:Uba2 / 308508 RGDID:1312023 Length:639 Species:Rattus norvegicus


Alignment Length:220 Identity:59/220 - (26%)
Similarity:88/220 - (40%) Gaps:57/220 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAAATLSFIN 139
            |.:||.||:|......|...|...:.|.|.|.::::|:||.| |.....|.||...|..::...:
  Rat    20 VLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFH 84

  Fly   140 PDVEIETHNYNIT----TVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNL 200
            |...||.|:.:|.    .||.|.:|:               ||::.:||..||..:|..|...::
  Rat    85 PQANIEAHHDSIMNPDYNVEFFRQFI---------------LVMNALDNRAARNHVNRMCLAADV 134

  Fly   201 NWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFL 265
            ...|||.:  ...|.:..|:.|.|.|:.|.|          |..:|      :.|       |..
  Rat   135 PLIESGTA--GYLGQVTTIKKGVTECYECHP----------KPTQR------TFP-------GCT 174

  Fly   266 VQNA----------LKYLLN--FGE 278
            ::|.          .|||.|  |||
  Rat   175 IRNTPSEPIHCIVWAKYLFNQLFGE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 59/220 (27%)
ThiF 53..310 CDD:279270 59/220 (27%)
Uba2NP_001094049.1 ThiF 9..>175 CDD:279270 51/194 (26%)
Uba2_SUMO 19..443 CDD:238766 59/220 (27%)
UAE_UbL 451..537 CDD:291402
UBA2_C 548..634 CDD:292812
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.