Sequence 1: | NP_572722.2 | Gene: | Uba5 / 32094 | FlyBaseID: | FBgn0030305 | Length: | 404 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094049.1 | Gene: | Uba2 / 308508 | RGDID: | 1312023 | Length: | 639 | Species: | Rattus norvegicus |
Alignment Length: | 220 | Identity: | 59/220 - (26%) |
---|---|---|---|
Similarity: | 88/220 - (40%) | Gaps: | 57/220 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 VAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAAATLSFIN 139
Fly 140 PDVEIETHNYNIT----TVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNL 200
Fly 201 NWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFL 265
Fly 266 VQNA----------LKYLLN--FGE 278 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Uba5 | NP_572722.2 | ThiF_MoeB_HesA_family | 52..297 | CDD:238386 | 59/220 (27%) |
ThiF | 53..310 | CDD:279270 | 59/220 (27%) | ||
Uba2 | NP_001094049.1 | ThiF | 9..>175 | CDD:279270 | 51/194 (26%) |
Uba2_SUMO | 19..443 | CDD:238766 | 59/220 (27%) | ||
UAE_UbL | 451..537 | CDD:291402 | |||
UBA2_C | 548..634 | CDD:292812 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0476 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |