DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Sae1

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001012063.1 Gene:Sae1 / 308384 RGDID:1306098 Length:349 Species:Rattus norvegicus


Alignment Length:368 Identity:74/368 - (20%)
Similarity:128/368 - (34%) Gaps:92/368 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ELETEPKSSGGVASNSRLARDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVG 82
            |.|......||::.......||             ..||..|:..      :|:|...|.|||:.
  Rat     3 EKEEVSGGGGGISEEEAAQYDR-------------QIRLWGLEAQ------KRLRASRVLIVGMK 48

  Fly    83 GVGSVTADMLTRCGIGKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAAATLSFINP--DVEI 144
            |:|:..|..|...|:..|.:.|:::|...::...| ......|.::..|:......:||  ||::
  Rat    49 GLGAEIAKNLILAGVKGLTMLDHEQVSPEDLGAQFLIRTGSVGQNRAEASLERAQNLNPMVDVKV 113

  Fly   145 ETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLNWFESGV-- 207
            :|.:.. ...|:|....|.:             .|:|... :..:.::..|:..::.:|...|  
  Rat   114 DTEDIE-KKPESFFTEFDAV-------------CLTCCSK-DVIIKVDQICHRNSIKFFTGDVFG 163

  Fly   208 ----------------SENAVSGHIQFIRPGDTACFA----------------CAPPLVVAENID 240
                            .:..|:...|.:..|..|..|                |  |:..|..:|
  Rat   164 YHGYTFANLGEHEFVEEKTKVTKVSQGVEDGPDAKRAKLDSSETTMVKKKVLFC--PVKEALAVD 226

  Fly   241 EKTLKREGVCAASLPTTMGITAGFLVQNALKYLLNFGE--VSDYLGYNA------LSDFFPKMTL 297
            ....|.:.....:.|..      ||:|..||:..:.|.  .||....:|      .:|.|..:.:
  Rat   227 WSGEKAQAALKRTAPDY------FLLQVLLKFRTDKGRDPTSDSYSEDAELLLQIRNDVFDSLGV 285

  Fly   298 KPNPQCDD--RNCLVRQKEFQARPKPVLIEE--KAVSE-EPLH 335
            .|:...||  |.|........|....:|.:|  ||:|: :|.|
  Rat   286 SPDLLPDDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPH 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 55/289 (19%)
ThiF 53..310 CDD:279270 60/303 (20%)
Sae1NP_001012063.1 Aos1_SUMO 19..344 CDD:238769 70/352 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.