DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and MOCS3

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_055299.1 Gene:MOCS3 / 27304 HGNCID:15765 Length:460 Species:Homo sapiens


Alignment Length:372 Identity:96/372 - (25%)
Similarity:138/372 - (37%) Gaps:93/372 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQAIIADLKTEL-------------ETEPKSS-----GGVASNSRLARDRIDRMSAEVVDSNPYS 54
            |||.:|..:.||             |.||:..     ..:...:.|:||.|.|          ||
Human    10 LQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILR----------YS 64

  Fly    55 RLMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLFFT 119
            |.:.|..:. |....|:....|.|||.||:|...|..|...|:|:|.|.|||.||::|:.|....
Human    65 RQLVLPELG-VHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLH 128

  Fly   120 PDQ-AGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVD 183
            .:. ||.:|..:|||:|..:|..||...:...:|..    ..||.:.:        .|:|..|.|
Human   129 GEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPA----TALDLVRR--------YDVVADCSD 181

  Fly   184 NFEARMAINAAC--NERNLNWFESGVSENAV--SGHIQFIRPGDTACFAC----APPLVVAENID 240
            |...|..:|.||  ..|.|      ||.:|:  .|.|.........|:.|    .||.....|  
Human   182 NVPTRYLVNDACVLAGRPL------VSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTN-- 238

  Fly   241 EKTLKREGVCAASLPTTMGITAGFL----VQNALKYLLNFGEVSDYLG----YNALSDFFPKMTL 297
                     ||..  ..:|:..|.|    ....||.....|  ..|.|    ::||...|..:.|
Human   239 ---------CADG--GVLGVVTGVLGCLQALEVLKIAAGLG--PSYSGSLLLFDALRGHFRSIRL 290

  Fly   298 KPN----PQCDDRNCLVRQKEFQA----------RPKPVLIEEKAVS 330
            :..    ..|.:|..:....:::|          |...:|..|:.||
Human   291 RSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 73/261 (28%)
ThiF 53..310 CDD:279270 76/277 (27%)
MOCS3NP_055299.1 ThiF_MoeB_HesA_family 62..285 CDD:238386 73/266 (27%)
RHOD_ThiF 327..460 CDD:238784 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.