DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Nae1

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_659180.1 Gene:Nae1 / 234664 MGIID:2384561 Length:534 Species:Mus musculus


Alignment Length:223 Identity:45/223 - (20%)
Similarity:75/223 - (33%) Gaps:64/223 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DELQAIIADLKTELETE--PKSSGGVASNSR-------------LARDRIDRMSAE--------- 46
            :..:..|.::.|.|.|.  |.|...:.::.|             |||...:.::.|         
Mouse   263 ENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPTFWILARALKEFVAKEGQGNLPVRG 327

  Fly    47 -----VVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYD 106
                 :.|||.|.:|..:.|....||             ...||:..|.:|...|.....:.: .
Mouse   328 TIPDMIADSNKYIKLQNVYREKAKKD-------------AAAVGNHVAKLLQSVGQAPESISE-K 378

  Fly   107 KVELANMNRLFF-------TPDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLDTI 164
            :::|...|..|.       ..::.||..|.......|..|||.||..: ..:..|:.|.:     
Mouse   379 ELKLLCSNSAFLRVVRCRSLAEEYGLDTVNKDEIISSMDNPDNEIVLY-LMLRAVDRFHK----- 437

  Fly   165 SQGGRIAG-------QPVDLVLSCVDNF 185
             |.||..|       :.:..:.||:..|
Mouse   438 -QHGRYPGVSNYQVEEDIGKLKSCLTGF 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 31/148 (21%)
ThiF 53..310 CDD:279270 31/147 (21%)
Nae1NP_659180.1 ThiF 9..>193 CDD:223552
APPBP1_RUB 11..532 CDD:238770 45/223 (20%)
Interaction with UBA3. /evidence=ECO:0000250 331..344 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.