DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Uba6

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_766300.1 Gene:Uba6 / 231380 MGIID:1913894 Length:1053 Species:Mus musculus


Alignment Length:511 Identity:109/511 - (21%)
Similarity:171/511 - (33%) Gaps:185/511 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DELQAIIADLKTELETEPK----------------------SSGGVASNSRL------------- 35
            |||..:...:...||.:|:                      :.|||||...|             
Mouse   352 DELLKLTVSINETLEEKPEVNADIVHWLSWTAQGFLPPLAAAVGGVASQEVLKAVTGKFSPLCQW 416

  Fly    36 ----ARDRIDRMSAEVVDSNP-----------YSRLMA---------LQRMNIVKDYERIRYKAV 76
                |.|.::.:      .||           |..:.|         ||.:||.           
Mouse   417 LYLEAADTVESL------GNPGHEEFLPRGDRYDAIRACIGNTLCQKLQNLNIF----------- 464

  Fly    77 AIVGVGGVGSVTADMLTRCGI------GKLILFDYDKVELANMNRLF-FTPDQAGLSK-VAAAAA 133
             :||.|.:|..........|:      |.:.:.|.|.:|.:|:||.| |.|......| ..||.|
Mouse   465 -LVGCGAIGCEMLKNFALLGVGTGREKGMVTVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAAEA 528

  Fly   134 TLSFINPDVEIETH-NYNITTVENF--DRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAAC 195
            ||. |||.::|:.| |......|:.  |.|.           ...|::::.:||.|||..:::.|
Mouse   529 TLK-INPQLKIDAHLNKVCPATESIYSDEFY-----------TKQDIIITALDNVEARRYVDSRC 581

  Fly   196 --NERNLNWFESGVSENAVSGHIQFIRPGDTACFAC--APPLVVAENIDEKTLKREGVCAASLPT 256
              |.|.|  .:||..  ...||.:.|.|..|..:..  .||   .|.|...|||       |.|.
Mouse   582 LANLRPL--LDSGTM--GTKGHTEIIVPQLTESYNSHRDPP---EEEIPFCTLK-------SFPA 632

  Fly   257 TMGITAGFLVQNALKYLLNFGEVSDYLGYNALSDFFPKMTLKPN---------PQCDD------- 305
                        |:::.:.:          |...|....:.||:         |..:|       
Mouse   633 ------------AIEHTIQW----------ARDKFESSFSHKPSLFNKFWQAYPSAEDVLQKIQN 675

  Fly   306 ----RNCLVRQKEFQARPK--PVLIE------EKAVSEEPLHATNEWGIELVAEDAPESNTTPAE 358
                ..|....|....||:  ...:|      ||..:.:.|...:.:.:|...:|......:|..
Mouse   676 GQSLEGCFQVIKLLSRRPRIWSQCVELARLKFEKYFNHKALQLLHCFPLETRLKDGSLFWQSPKR 740

  Fly   359 TPV-----MGEGLRLAY-EAPEKSSET------SEETVSAATADETSLEDLMAQMK 402
            .|.     :.|.|.|:: ::..|...|      ||:.:|.     .||.|:::::|
Mouse   741 PPSPIKFDLNEPLHLSFLQSAAKLYATVYCIPFSEKDLSV-----NSLMDILSEVK 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 66/279 (24%)
ThiF 53..310 CDD:279270 70/300 (23%)
Uba6NP_766300.1 Ube1 38..1046 CDD:273603 109/511 (21%)
Ube1_repeat1 43..432 CDD:238768 15/85 (18%)
E1_4HB 299..362 CDD:292809 3/9 (33%)
Ube1_repeat2 462..1005 CDD:238767 89/395 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.