DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Uba1

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_033483.2 Gene:Uba1 / 22201 MGIID:98890 Length:1118 Species:Mus musculus


Alignment Length:423 Identity:83/423 - (19%)
Similarity:147/423 - (34%) Gaps:139/423 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ERIRYKAVAIVGVGGVGSVTADMLTRCGI-----GKLILFDYDKVELANMNRLF-FTPDQAGLSK 127
            |::..:...:||.|.:|..........|:     |::::.|.|.:|.:|:||.| |.|......|
Mouse   524 EKLSKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEVVVTDMDTIEKSNLNRQFLFRPWDVTKLK 588

  Fly   128 VAAAAATLSFINPDVEIETHNYNI----TTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEAR 188
            ...|||.:..:||.:::.:|...:    ..:.:.|.|            |.:|.|.:.:||.:||
Mouse   589 SDTAAAAVRQMNPYIQVTSHQNRVGPDTERIYDDDFF------------QNLDGVANALDNIDAR 641

  Fly   189 MAINAACNERNLNWFESGVSENAVSGHIQFIRPGDTACFACA--PPLVVAENIDEKTLKREGVCA 251
            |.::..|........|||..  ...|::|.:.|..|..::.:  ||        ||::.   :|.
Mouse   642 MYMDRRCVYYRKPLLESGTL--GTKGNVQVVIPFLTESYSSSQDPP--------EKSIP---ICT 693

  Fly   252 -ASLPTTMGITAGFLVQNALKYLLNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRNCLVRQKEF 315
             .:.|            ||:::.|.:..           |.|..:..:|   .::.|..:...:|
Mouse   694 LKNFP------------NAIEHTLQWAR-----------DEFEGLFKQP---AENVNQYLTDSKF 732

  Fly   316 QAR--------PKPVL--IEEKAVSEEP-------LHATNEW------GIELVAEDAPESNTTPA 357
            ..|        |..||  ::...|.:.|       ..|.:.|      .|..:..:.|....|.:
Mouse   733 VERTLRLAGTQPLEVLEAVQRSLVLQRPQTWGDCVTWACHHWHTQYCNNIRQLLHNFPPDQLTSS 797

  Fly   358 ETPV--------------MGEGLRLAY------------------------------EAPE---- 374
            ..|.              :...|.|.|                              :.||    
Mouse   798 GAPFWSGPKRCPHPLTFDVNNTLHLDYVMAAANLFAQTYGLTGSQDRAAVASLLQSVQVPEFTPK 862

  Fly   375 ---KSSETSEETVSA-ATADETSLEDLMAQMKS 403
               |...:.:|..|| |:.|::.||:|.|.:.|
Mouse   863 SGVKIHVSDQELQSANASVDDSRLEELKATLPS 895

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 52/240 (22%)
ThiF 53..310 CDD:279270 54/253 (21%)
Uba1NP_033483.2 ThiF 109..1115 CDD:330201 83/423 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.