DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and aos-1

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_505604.2 Gene:aos-1 / 179409 WormBaseID:WBGene00000142 Length:350 Species:Caenorhabditis elegans


Alignment Length:273 Identity:53/273 - (19%)
Similarity:96/273 - (35%) Gaps:61/273 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ARDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKL 100
            |::.::...||....:...||..::..|      :||...|.|:|...:|:..|..|:..|:.::
 Worm     4 AKENMEVSKAEQAIYDRQIRLWGMEAQN------KIRNSKVLIIGGKQLGAEVAKTLSLAGVDEM 62

  Fly   101 ILFDYDKVELANMNRLFFTPDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFL---D 162
            .|.|:..|:...:...|........||:...||:.:|:          ||:.  .|...|:   |
 Worm    63 HLVDHRLVDTEEIGMNFLYDASVDNSKMTKWAASYNFL----------YNLN--RNVKLFIVEED 115

  Fly   163 TISQGGRIAGQ---PVDLVLSCVDNFEARMAINAACNERNLNWFESGVSENAV-------SGHIQ 217
            .:|:......:   ...||:...:::|....:|..|.:.::. |.||.....:       .||..
 Worm   116 VLSKNDSEIEEYLTKFTLVVVLDESYERTAKVNNICRKHHIR-FISGAIYGWIGYAFFDFDGHAY 179

  Fly   218 FIRPGDTACF------------------------ACAPPLVVAENIDEKTLKREGVCAASLPTTM 258
            .::.....|.                        ...|..|...|.|....|....|...:||:.
 Worm   180 LVKAKSPDCLNEEESETGKTSTVVTVDEEFVLETFSYPSFVETLNSDFTAKKIVRKCKRIVPTSY 244

  Fly   259 GITAGFLVQNALK 271
                 |||::.|:
 Worm   245 -----FLVKSMLR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 50/257 (19%)
ThiF 53..310 CDD:279270 50/256 (20%)
aos-1NP_505604.2 E1-1_like 17..345 CDD:238762 50/260 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.