DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and moc-3

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_501359.1 Gene:moc-3 / 177607 WormBaseID:WBGene00018357 Length:402 Species:Caenorhabditis elegans


Alignment Length:191 Identity:54/191 - (28%)
Similarity:84/191 - (43%) Gaps:24/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANM 113
            |:..|||.:.:.... |...:.::...|.|||.||:|...|..|...|||.:.:.|||.:.|.|:
 Worm    14 DAGRYSRQLLVDDFG-VSGQKNLKNLNVLIVGAGGLGCPVATYLGAAGIGTIGIVDYDHISLDNL 77

  Fly   114 NR-LFFTPDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDL 177
            :| :.:..||.|.||..|.|..:...|.|:.::.||.::.:......|            :..::
 Worm    78 HRQVAYKEDQVGKSKAQALADNIKLQNSDLNVQVHNTSLDSSNAMQLF------------KNYEI 130

  Fly   178 VLSCVDNFEARMAINAACNERNLNWFESGVSENAV--SGHIQFIRPG-DTACFAC---APP 232
            |..|.||...|..||..|...|:..    ||.:|:  .|.:.....| |..|:.|   :||
 Worm   131 VCDCTDNVATRYLINDVCVLLNIPL----VSGSALRWDGQLSVYHYGSDCPCYRCLFPSPP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 53/188 (28%)
ThiF 53..310 CDD:279270 53/187 (28%)
moc-3NP_501359.1 PRK07878 8..402 CDD:181156 54/191 (28%)
ThiF_MoeB_HesA_family 17..246 CDD:238386 53/188 (28%)
RHOD_ThiF 283..402 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.