DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and Uba3

DIOPT Version :10

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_476553.1 Gene:Uba3 / 117553 RGDID:621084 Length:462 Species:Rattus norvegicus


Alignment Length:218 Identity:56/218 - (25%)
Similarity:88/218 - (40%) Gaps:56/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAAATLSFIN 139
            |.::|.||:|......|...|..::.:.|.|.::::|:||.| |.|...|..|...||   .|:|
  Rat    72 VLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDVGRPKAEVAA---EFLN 133

  Fly   140 PDVEIETHNYNITTVENFDR---FLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLN 201
            ..|.      |...|.:|::   |.||..       :...:::..:|:..||..||...... ||
  Rat   134 DRVP------NCNVVPHFNKIQDFNDTFY-------RQFHIIVCGLDSIIARRWINGMLISL-LN 184

  Fly   202 WFESGVSE------------NAVSGHIQFIRPGDTACFACA----PPLVVAENIDEKTLKREGVC 250
             :|.||.:            ....|:.:.|.||.|||..|.    ||.|   |....|:      
  Rat   185 -YEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQV---NFPMCTI------ 239

  Fly   251 AASLPTTMGITAGFLVQNALKYL 273
             ||:|.        |.::.::|:
  Rat   240 -ASMPR--------LPEHCIEYV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 56/218 (26%)
Uba3NP_476553.1 Interaction with UBE2M N-terminus. /evidence=ECO:0000250 53..70
Uba3_RUB 71..368 CDD:238765 56/218 (26%)
Interaction with UBE2M N-terminus. /evidence=ECO:0000250 157..161 0/3 (0%)
Interaction with UBE2M N-terminus. /evidence=ECO:0000250 192..217 3/24 (13%)
Interaction with NEDD8. /evidence=ECO:0000250 227..229 0/1 (0%)
Interaction with NAE1. /evidence=ECO:0000250 242..248 2/13 (15%)
Interaction with NAE1. /evidence=ECO:0000250 292..295
Interaction with UBE2M N-terminus. /evidence=ECO:0000250 331..338
Interaction with NEDD8. /evidence=ECO:0000250 352..357
Interaction with UBE2M core domain. /evidence=ECO:0000250 368..462
E2_bind 376..461 CDD:462611
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.