DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and SAE1

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_005491.1 Gene:SAE1 / 10055 HGNCID:30660 Length:346 Species:Homo sapiens


Alignment Length:398 Identity:69/398 - (17%)
Similarity:121/398 - (30%) Gaps:174/398 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EPKSSGGVASNSRLARDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVGGVGS 86
            |.:.:||..|....|:               |.|.:.|..:...|   |:|...|.:||:.|:|:
Human     3 EKEEAGGGISEEEAAQ---------------YDRQIRLWGLEAQK---RLRASRVLLVGLKGLGA 49

  Fly    87 VTADMLTRCGIGKLILFDYDKVELANMNRLFFTPD-----------QAGLSKVAAAAATLSFINP 140
            ..|..|...|:..|.:.|:::|          ||:           ..|.::..|:......:||
Human    50 EIAKNLILAGVKGLTMLDHEQV----------TPEDPGAQFLIRTGSVGRNRAEASLERAQNLNP 104

  Fly   141 --DVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLNWF 203
              ||:::|.:                                                       
Human   105 MVDVKVDTED------------------------------------------------------- 114

  Fly   204 ESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFLVQN 268
               :.:...|...||    |..|..|....|:        :|.:.:|.               :|
Human   115 ---IEKKPESFFTQF----DAVCLTCCSRDVI--------VKVDQICH---------------KN 149

  Fly   269 ALKYLLNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRNCLVRQKEFQARPKPVLIEEKAVSEEP 333
            ::|:..  |:|..|.||...:                    :.:.||        :|||      
Human   150 SIKFFT--GDVFGYHGYTFAN--------------------LGEHEF--------VEEK------ 178

  Fly   334 LHATNEWGIELVAEDAPE--------SNTTPAETPVMGEGLRLAYEAPEKSSETSEETVSAATAD 390
               |....:....||.|:        |.||..:..|:...::.|.|. :.|||.::..:...|:|
Human   179 ---TKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEV-DWSSEKAKAALKRTTSD 239

  Fly   391 ETSLEDLM 398
            ...|:.|:
Human   240 YFLLQVLL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 42/257 (16%)
ThiF 53..310 CDD:279270 42/269 (16%)
SAE1NP_005491.1 Aos1_SUMO 16..341 CDD:238769 65/385 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.