DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and mocs3

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_031758108.1 Gene:mocs3 / 100491723 XenbaseID:XB-GENE-5804173 Length:455 Species:Xenopus tropicalis


Alignment Length:332 Identity:78/332 - (23%)
Similarity:117/332 - (35%) Gaps:96/332 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHAIDELQAIIADLKTELETEPKSSGGVASNSRLARDRIDRMSAEVVDSNPYSRLMALQRMNIVK 66
            ||..||   |:.:|.....|.|                         |...|||.:.|.... |:
 Frog    37 SHGADE---ILPELNKSSLTNP-------------------------DILRYSRQLVLPEFG-VQ 72

  Fly    67 DYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNR-LFFTPDQAGLSKVAA 130
            ....:...:|.::|.||:|...|..|...|||:|.|.|||.||::|::| :....::.|:.|..:
 Frog    73 GQLNLSKVSVLVIGCGGLGCPVAQYLAASGIGRLGLLDYDVVEMSNLHRQVLHGENRLGMPKSVS 137

  Fly   131 AAATLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAAC 195
            ...||..:|..|....::.::    |.:..|..|.|        .|::..|.||...|..:|.||
 Frog   138 IVKTLQKLNSSVIYLPYHMSL----NPENGLQIIRQ--------YDIIADCSDNVPTRYLVNDAC 190

  Fly   196 --------NERNLNWFESGVSENAVSGHIQFIRPGDTACFAC----APPLVVAENIDEKTLKREG 248
                    :...|.|          .|.:.........|:.|    .||.....|          
 Frog   191 VLAGKPLVSASALRW----------EGQLTVYNYQQGPCYRCLFPKPPPSETVTN---------- 235

  Fly   249 VCAASLPTTMGITAGFLVQ-NALKYL-LNFGEVSDYLG----YNALSDFFPKMTLKPNPQCDDRN 307
             ||..  ..:||..|.:.. .||:.| :..|.|..|.|    ::||...|             ||
 Frog   236 -CADG--GVLGIVPGIIGSLQALEVLKIASGMVPSYSGVLLMFDALEGRF-------------RN 284

  Fly   308 CLVRQKE 314
            ..:|.|:
 Frog   285 IKIRGKQ 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 65/263 (25%)
ThiF 53..310 CDD:279270 67/275 (24%)
mocs3XP_031758108.1 ThiF_MoeB_HesA_family 59..287 CDD:238386 67/276 (24%)
RHOD 324..455 CDD:412175
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.