DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba5 and uba7

DIOPT Version :9

Sequence 1:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_005155933.1 Gene:uba7 / 100001302 ZFINID:ZDB-GENE-121120-4 Length:1016 Species:Danio rerio


Alignment Length:324 Identity:72/324 - (22%)
Similarity:115/324 - (35%) Gaps:98/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LETEPKSSGGVASNSRLA-RD-RIDRMSAEVVDSNPYSRLMALQRMNIVKDYE-RIRYKAVAIVG 80
            ||..|:..|||.|....| || |.|...| |..|                |:: :::.:...:||
Zfish   386 LECLPQEEGGVLSEDACAPRDSRYDGQIA-VFGS----------------DFQNKLKKQKYFLVG 433

  Fly    81 VGGVGSVTADMLTRCGI-----GKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAAATLSFIN 139
            .|.:|..........|:     |.:.:.|.|.:|.:|:||.| |.....|..|..|||..:..:|
Zfish   434 AGAIGCELLKNFALIGLGAGEGGSITVTDMDSIERSNLNRQFLFRSQDIGRPKSEAAAEAVKEMN 498

  Fly   140 PDVEIETHNYNITTVENFDRFLDTISQGGRIAGQP-----------VDLVLSCVDNFEARMAINA 193
            |                   |::.|:|..|:..:.           :|.|.:.:||.:||:.::.
Zfish   499 P-------------------FMNIIAQQNRVCAETEEVYTHSFYTGLDGVAAALDNVDARVYLDQ 544

  Fly   194 ACNERNLNWFESGVSENAVSGHIQFIRPGDTACFAC-------APPLVVAENID---EKTLK--- 245
            .|........|.|...:  .||...:.|..|..:..       |.|:...:|..   |.||:   
Zfish   545 CCVRNKKPMLEGGTLGS--KGHTMVVVPRLTESYGLSSSGGQKAIPICTLKNFPHRIEHTLQWAR 607

  Fly   246 --REGVCAASLPTTMGITAGFLVQNALKYLLNFGEVSDYLG-------------YNALSDFFPK 294
              .||:...:            .||...:|.:.|.|...:.             |.:|||.:|:
Zfish   608 DHFEGLFKQT------------AQNVNNFLSDPGFVDRTVARGDVEAVEMLEGVYRSLSDDWPE 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 57/289 (20%)
ThiF 53..310 CDD:279270 57/288 (20%)
uba7XP_005155933.1 Ube1 5..1013 CDD:273603 72/324 (22%)
Ube1_repeat1 10..393 CDD:238768 3/6 (50%)
E1_4HB 258..326 CDD:292809
E1_enzyme_family 428..970 CDD:304554 56/265 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.