DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g15 and CYP4F2

DIOPT Version :9

Sequence 1:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:561 Identity:163/561 - (29%)
Similarity:275/561 - (49%) Gaps:82/561 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLPTLVLW-YIYWRLSRAHLYRLAGRLPGPRGLPIVGHLFDVIGPASSVFRTVIRKSAPFEHIAK 84
            ||..::.| |.::...|    ||......||.....||. .::.|.....|.:.:..|.:....|
Human    30 LLAHVLAWTYAFYDNCR----RLRCFPQPPRRNWFWGHQ-GMVNPTEEGMRVLTQLVATYPQGFK 89

  Fly    85 MWIGP-KLVVFIYDPRDVELLLSSHVYIDKASE--YKFFKPWLGDGLLISTGQKWRSHRKLIAPT 146
            :|:|| ..::.:..|..:..::::...|....:  |.|.:||||||||:|.|.||..||:::.|.
Human    90 VWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLTPA 154

  Fly   147 FHLNVLKSFIELFNENSRNVV----RKLRAEDGRTFDCHDYMSEATVEILLETAMGVSKKTQDKS 207
            ||.|:||.::::||| |.|::    :.|.:|.....|..:::|..|::.|.:.........|:|.
Human   155 FHFNILKPYMKIFNE-SVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKP 218

  Fly   208 GFEYAMAVMRMCDILHARHRSIFLRNEFVFTLTRYYKEQGRLLNIIHGLTTKVIRSKKAAFEQGT 272
            . ||..|::.:..::..||..|.|..:|::.||...:...|...::|..|..||:          
Human   219 S-EYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQ---------- 272

  Fly   273 RGSLAQCELKAAALEREREQNGGVDQTPSTAGSDEKDREKDKEKASPVAGLSYGQSAGLKDDLDV 337
                          ||.|        |..:.|.|:..:.|.|.|.                    
Human   273 --------------ERRR--------TLPSQGVDDFLQAKAKSKT-------------------- 295

  Fly   338 EDNDIGEKKRLAFLD-LMLESAQNGALITDTEIKEQVDTIMFEGHDTTAAGSSFFLSLMGIHQDI 401
                      |.|:| |:|...::|..::|.:|:.:.||.|||||||||:|.|:.|..:..|.:.
Human   296 ----------LDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEY 350

  Fly   402 QDRVLAELDSIFGDSQ-RPATFQDTLEMKYLERCLMETLRMYPPVPLIARELQEDLKLNSGNYVI 465
            |:|...|:..:..|.: :...:.|...:.:|..|:.|:||::||||:|:|.:.:|:.|..|. ||
Human   351 QERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGR-VI 414

  Fly   466 PRGATVTVATVLLHRNPKVYANPNVFDPDNFLPERQANRHYYAFVPFSAGPRSCVGRKYAMLKLK 530
            |:|....::....|.||.|:.:|.|:||..|.||....|...||:|||||||:|:|:.:||.::|
Human   415 PKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMK 479

  Fly   531 ILLSTILRNYRVYSDLTESDFKLQADIILKREEGFRVRLQP 571
            ::|:..|..:||..|.||.  :.:.:::|:.|.|..:|::|
Human   480 VVLALTLLRFRVLPDHTEP--RRKPELVLRAEGGLWLRVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 146/503 (29%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 8/30 (27%)
p450 52..515 CDD:365848 154/530 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.