DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g15 and CYP96A14P

DIOPT Version :9

Sequence 1:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_176777.1 Gene:CYP96A14P / 842916 AraportID:AT1G66030 Length:167 Species:Arabidopsis thaliana


Alignment Length:167 Identity:34/167 - (20%)
Similarity:65/167 - (38%) Gaps:41/167 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFYFLLLPTLVLWYIYWRLSRAHLYR--LAGRLPG-----PRGLPIVGHLFDVIGPASSVFRTVI 73
            :||:.|:.. ...||..::|::.|:.  :.|..||     ||   |.....|::..::..|    
plant    18 IFYYFLIKK-PYSYILIKISQSGLWNWPVLGMSPGALMRLPR---IYDFSVDLLENSNLTF---- 74

  Fly    74 RKSAPFEHIAKMWIGPKLVVFIYDPRDVELLLSSHVYIDKASEYKFFKPWLGDGLLISTGQKWRS 138
                   |....|.....::...|..::     :|:|.......:.|.|: |||::.|..:.||:
plant    75 -------HFKGPWFAGIDILATADSVNI-----NHIYYRGPELREIFGPF-GDGIINSDSELWRN 126

  Fly   139 HRKLIAPTFHLNVLKSF-------------IELFNEN 162
            .:|.....|:....:.|             :.|||::
plant   127 LKKATQVIFNHQKYQKFSTSTTRSKLKLGLVPLFNDH 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 26/134 (19%)
CYP96A14PNP_176777.1 p450 1..>166 CDD:386267 34/167 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.