DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g15 and CYP72C1

DIOPT Version :9

Sequence 1:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:270 Identity:60/270 - (22%)
Similarity:104/270 - (38%) Gaps:60/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PRGLPIVGHLFDVIGPASSVFRTVIRKSAPFEHIAK--MWIGPKLVVFIYDPRDVELLLSSHVYI 111
            ||.:|.:.|             ||::      |..|  .|.||...|.:.||..:..::|.|.. 
plant    81 PRMMPFLHH-------------TVLK------HGKKCFTWYGPYPNVIVMDPETLREIMSKHEL- 125

  Fly   112 DKASEYKFFKPWLG-------DGLLISTGQKWRSHRKLIAPTFHLNVLKSFIELFNENSRNVV-- 167
                   |.||.:|       .|||...|.||..||.::.|.|.::.|||.:..||.:.:.::  
plant   126 -------FPKPKIGSHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEE 183

  Fly   168 --RKLRAEDGRTFD----CHDYMSEATVEILLETAMGVSKKTQDKSGFEYAMAVMRMCDILHARH 226
              |...|:.....|    |||    .|..:|...:.|.|.    |.|.:.........|:.....
plant   184 WERLASAKGTMELDSWTHCHD----LTRNMLARASFGDSY----KDGIKIFEIQQEQIDLGLLAI 240

  Fly   227 RSIFLRNEFVFTLTRYYKEQGRLLNIIHGLTTKVIRSKKAAFEQGTRGS------LAQCELKAAA 285
            |::::... .|..|::.:........:..:...:|.:|:...::| ||:      .::|.|:...
plant   241 RAVYIPGS-KFLPTKFNRRLRETERDMRAMFKAMIETKEEEIKRG-RGTDKNSDCCSRCWLRIQK 303

  Fly   286 LEREREQNGG 295
            ..:.::|..|
plant   304 PSKNKDQIQG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 60/270 (22%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.