DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g15 and CYP71A18

DIOPT Version :9

Sequence 1:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001184964.1 Gene:CYP71A18 / 837705 AraportID:AT1G11610 Length:504 Species:Arabidopsis thaliana


Alignment Length:570 Identity:112/570 - (19%)
Similarity:209/570 - (36%) Gaps:167/570 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLPTLVLWYIYWRLSRAHLYRLAGRL---PGPRGLPIVGHLFDV-IGPASSVFRTVIRKSAPFE 80
            |.|.||:...    |.:..|.|.|.::   |.|..:|::|:|..: :.|..|:            
plant     9 LCLTTLLTLL----LLKKFLKRTAKKVNLPPSPWRIPVIGNLHQLSLHPHRSL------------ 57

  Fly    81 HIAKMWIGPKLVVFIYDPRDVELLLSS----HVYIDKASEYKF--------------------FK 121
            |...:..||  ::.::..|...|::||    |..: |..:.||                    |.
plant    58 HSLSLRYGP--LMLLHFGRVPILVVSSSEAAHEIL-KTHDLKFANRPKSKAVHGLMNGGRDVVFG 119

  Fly   122 PWLGDGLLISTGQKWRSHRKLIAPTFHLNVLKSFIELFNENSRNVVRKLRAEDGRTFDCHDYMSE 186
            |:         |:.||..:.:.......|.:.:..|...|...|.:.: :.|........:.:||
plant   120 PY---------GEYWRQMKSVCILNLLTNKMVASFEKVREEEVNAMME-KLEKASCSSSAENLSE 174

  Fly   187 ATVEILLETAMGVS---KKTQDKSGFEYAMAVMRMCDILHARHRSIFLRNEFVFTLTRYYKEQGR 248
            ..|.:..:....||   |..:|::.......|.::.::|..     |...::|..|.        
plant   175 LFVTLTSDVTSRVSLGKKYWEDETAGGLKKRVRQIMELLRE-----FPIGDYVPALA-------- 226

  Fly   249 LLNIIHGLTTKVIRSKKA---AFEQGTRGSLAQCELKA----AALEREREQNGGVDQTPSTAGSD 306
            .::.|:|..:|::...:|   ..|:..:..|...|.||    ..|..|:|:|.|           
plant   227 WIDRINGFNSKIVEVSRAYSDLMEKVVQEHLEAGEHKADFVNILLSIEKEKNNG----------- 280

  Fly   307 EKDREKDKEKASPVAGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLDLMLESAQNGALITDTEIKE 371
                                        ..|:.|||    :...||:.:     |.:.|.:.:.|
plant   281 ----------------------------FKVQRNDI----KFMILDMFI-----GGISTSSTLLE 308

  Fly   372 QVDTIMFEGHDTTAAGSSFFLSLMGIHQDIQDRVLAELDSIFGDSQRP----ATFQDTLEMKYLE 432
            .:.|.:....:..              :.:|:.:.:.:        ||    ...::...|:||:
plant   309 WIMTELIRNPECM--------------KKLQNEIRSTI--------RPHGSYIKEKEVENMRYLK 351

  Fly   433 RCLMETLRMYPPVPLI-ARELQEDLKLNSGNYVIPRGATVTVATVLLHRNPKVYANPNVFDPDNF 496
            ..:.|..|::||:||| .|.|.||:|:.  .|.|..|..|.:....:||:|.::..    |.:.|
plant   352 AVIKEVFRVHPPLPLILPRLLTEDVKVK--GYDIAAGTEVLINAWSIHRDPAIWGP----DAEEF 410

  Fly   497 LPER--QANRHYYA----FVPFSAGPRSCVGRKYAMLKLKILLSTILRNY 540
            .|||  .:...|:.    ::||.:|.|.|.|...||..:::.|:.::..:
plant   411 KPERHLDSTLDYHGQDLKYIPFGSGRRICPGINLAMGLVEVTLANLVGRF 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 104/540 (19%)
CYP71A18NP_001184964.1 p450 26..496 CDD:299894 106/549 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.