DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g15 and CYP96A4

DIOPT Version :9

Sequence 1:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_200045.1 Gene:CYP96A4 / 835308 AraportID:AT5G52320 Length:502 Species:Arabidopsis thaliana


Alignment Length:552 Identity:115/552 - (20%)
Similarity:214/552 - (38%) Gaps:129/552 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PIVGHLFDVIGPASSVFRTVIRKSAPFEHIAKMWIGPKL----VVFIYDPRDVELLLSSH-VYID 112
            |::|.|..|:.....:: ..:.::...|::...:|||.|    ::...||.:::.:|||: |...
plant    38 PVLGMLPGVLFQIPRIY-DFVTEALEAENMTGCFIGPWLSGTDILLTVDPVNIQYILSSNFVNYP 101

  Fly   113 KASEYKFFKPWLGDGLLISTGQKWRSHRKLIAPTFHLNVLKSF--IELFNENSRNVVRKL--RAE 173
            |..::.....:||||:.......|...|......|.....:||  ....::.|:.:|..|  ..|
plant   102 KGKKFNKIFEFLGDGIFNVDSGLWEDMRNSSHAIFSHQDFQSFSVSTSVSKLSQGLVPILDNAVE 166

  Fly   174 DGRTFDCHDYMSEATVEILLETAMGVSKKTQDKS------GFEYAMAVMRMCDILHARHRSIFLR 232
            .....|..|...    ..|.:|:..:......||      ..|:|.|:..:.|.:..||    |:
plant   167 KHILVDLQDLFQ----RFLFDTSSTLMAGYDPKSLSVEMPKVEFADAMDGVADAMFYRH----LK 223

  Fly   233 NEFVFTLTRYY-----KEQGRLLNIIHGLTTKVIRSKKAAFEQGTRGSLAQCELKAAALEREREQ 292
            ..|::::..:.     |:..|.|::...:..|:|.:|                       ||..:
plant   224 PAFLWSIQSWIGVGIEKKMRRGLDVFDQMLGKIISAK-----------------------REEIK 265

  Fly   293 NGGVDQTPSTAGSDEKDREKDKEKASPVAGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLDLMLES 357
            |.|:        .|.|....|.        |:|..:.           |..:.|.|        .
plant   266 NHGI--------HDSKGEAMDV--------LTYYMTI-----------DTTKYKHL--------K 295

  Fly   358 AQNGALITDTEIKEQVDTIMFEGHDTTAAGSSFFLSLMGIHQDIQDRVLAELDSIFGDSQRPATF 422
            ..|...|.||     :..::....|||::..::|..|:..:.:...::..|:      :::...|
plant   296 PSNDKFIRDT-----ILGLVIAARDTTSSALTWFFWLLSKNPEAMTKIRQEI------NKKMPKF 349

  Fly   423 Q--DTLEMKYLERCLMETLRMYPPVPLIARELQEDLKLNSGNYVIPRGATVTVATVLLHRNPKVY 485
            .  |..::.||:..:.||||:||.||...:...:...|.|| :.:.:...|.:....|.|...|:
plant   350 DPADLDKLVYLDGAVCETLRLYPSVPFNHKSPAKPDVLPSG-HKVDKNWRVVIPIYSLGRMKSVW 413

  Fly   486 ANPNVFDPDNFLPERQAN-------RHYYAFVPFSAGPRSCVGRKYAMLKLKILLSTILRNYRVY 543
            .:    |.::|.|||..:       ...|.|:.|:||||:|:|::...|::|.:...|:|||   
plant   414 GD----DAEDFRPERWISDSGMLRQESSYKFLAFNAGPRTCLGKRLTFLQMKTVAVEIIRNY--- 471

  Fly   544 SDLTESDFKL--------QADIILKREEGFRV 567
                  |.|:        ...::|:.:.|.:|
plant   472 ------DIKVVEGHKPKPVPSVLLRMQHGLKV 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 110/517 (21%)
CYP96A4NP_200045.1 p450 1..501 CDD:416425 115/552 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.