DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g15 and CYP94B3

DIOPT Version :9

Sequence 1:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_190421.1 Gene:CYP94B3 / 824011 AraportID:AT3G48520 Length:506 Species:Arabidopsis thaliana


Alignment Length:580 Identity:121/580 - (20%)
Similarity:215/580 - (37%) Gaps:172/580 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLLLPTLVLWYIYWRLSRAHLYRLAGRLP-GPRGLPIVGHLFDVIGPASSVFR--TVIRKSAPFE 80
            ||:|..|:.  |.:.||.:...::..... ||...|::|.:.........:.:  |.:.:.:|.:
plant     7 FLILAFLIT--IIFFLSSSSTKKVQENTTYGPPSYPLIGSILSFNKNRHRLLQWYTELLRLSPSQ 69

  Fly    81 HIAKMWIGPKLVVFIYDPRDVELLLSSHVYIDKASEYKFFKPW-------LGDGLLISTGQKWRS 138
            .|....:|.:..:...:|.:||.:|.::.:     .:...||:       ||.|:....|..|.|
plant    70 TILVPLLGNRRTIITTNPLNVEYILKTNFF-----NFPKGKPFTDLLGDLLGGGIFNVDGHSWSS 129

  Fly   139 HRKLIAPTFHLNVLKSF-IELFNENSRN---VVRKLRAEDGRTFDCHDYMSEATVEILLETAMGV 199
            .|||.:..|....|:|| .|:..:...|   .|....|:.|.|.|..|.:.....:::.:.::|.
plant   130 QRKLASHEFSTRSLRSFAFEVLKDEVENRLVPVLSTAADVGTTVDLQDVLKRFAFDVVCKVSLGW 194

  Fly   200 SKKTQDKS--------GFEYA--MAVMRMCDILHARHRSIFLRNEFVFTLTRYYKEQGRLLNI-- 252
            .....|.:        .|:.|  ::..|..:.::|                 .:|.: |:||:  
plant   195 DPDCLDLTRPVNPLVEAFDTAAEISARRATEPIYA-----------------VWKTK-RVLNVGS 241

  Fly   253 ----------IHGLTTKVIRSKKAAFEQGTRGSLAQCELKAAALEREREQNGGVDQTPSTAGSDE 307
                      :|.|.::::|:||.:.|.||                                   
plant   242 ERKLREAIRTVHVLVSEIVRAKKKSLEIGT----------------------------------- 271

  Fly   308 KDREKDKEKASPVAGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLDLMLESAQNGALITDTEIKEQ 372
                                .|..|.||               |...|.:..||..:.|     .
plant   272 --------------------GAEAKQDL---------------LSRFLAAGHNGEAVRD-----M 296

  Fly   373 VDTIMFEGHDTTAAGSSFFLSLMGIHQDIQDRVLAELDSI----FGDSQRPATFQDTLEMKYLER 433
            |.:.:..|.|||:|..::...|:..:.|::.::|.|:|.:    .|       |:|..||.|.:.
plant   297 VISFIMAGRDTTSAAMTWLFWLLTENDDVERKILEEVDPLVSLGLG-------FEDLKEMAYTKA 354

  Fly   434 CLMETLRMYPPVPLIARELQEDLKLNSGNYVIPRGATVTVATVLLHRNPKVYANPNVFDPDNFLP 498
            ||.|.:|:||||...::....|..|..|..| .||..||.....:.|...::..    |.:.|.|
plant   355 CLCEAMRLYPPVSWDSKHAANDDVLPDGTRV-KRGDKVTYFPYGMGRMETLWGT----DSEEFNP 414

  Fly   499 ERQANRHY----------------YAFVPFSAGPRSCVGRKYAMLKLKILLSTILRNYRV 542
                ||.:                |.|..|.||||.|||::.|.:::|.::.::|..:.:
plant   415 ----NRWFDSEPGSTRPVLKPISPYKFPVFQAGPRVCVGKEMAFMQMKYVVGSVLSRFEI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 114/550 (21%)
CYP94B3NP_190421.1 p450 46..501 CDD:386267 110/539 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.