DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g15 and CYP94B2

DIOPT Version :9

Sequence 1:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_566155.1 Gene:CYP94B2 / 821263 AraportID:AT3G01900 Length:496 Species:Arabidopsis thaliana


Alignment Length:598 Identity:122/598 - (20%)
Similarity:223/598 - (37%) Gaps:157/598 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLLLPTLVLWYIYWRLSRAHLYRLAGRLPGPRGLPIVGHLFDVIGPASSV--FRTVIRKSAPFEH 81
            |:||..|||..:  ...:..:|  :.|...|:..|::|.|.......:.:  :.|.:...:|...
plant     6 FILLLVLVLLLV--SAGKHVIY--SCRNSTPKTYPVIGCLISFYTNRNRLLDWYTELLTESPSRT 66

  Fly    82 IAKMWIGPKLVVFIYDPRDVELLLSSHVYIDKASEYKFFKP-------WLGDGLLISTGQKWRSH 139
            :....:..:..|...:|.:||.:|.::.     ..|...||       :||:|:....|..|...
plant    67 VVIRRLAARRTVVTANPSNVEYILKTNF-----DNYPKGKPFTEILGDFLGNGIFNVDGNLWLKQ 126

  Fly   140 RKLIAPTFHLNVLKSFIELFNENSRNVVRK-------LRAEDGRTFDCHDYMSEATVEILLETAM 197
            |:|....|....|:.::.:.    ||.|.|       ..|||.:.||..:.:...|..|:....:
plant   127 RRLATHDFTPKSLREYVTVL----RNEVEKELLAFLNAAAEDSQPFDLQELLRRFTFNIVCIVFL 187

  Fly   198 GVSKKTQDKS--------GFEYAMAVMRMCDILHARHRSIFLRNEFVFTLTRYY-----KEQGRL 249
            |:.:.|.:.|        .|:.|.||       .|...|..|  .||:...|..     ||..:.
plant   188 GIDRCTLNPSSPVSEFDRAFQTASAV-------SAGRGSAPL--SFVWKFKRLVGFGSEKELRKA 243

  Fly   250 LNIIHGLTTKVIRSKKAAFEQGTRGSLAQCELKAAALEREREQNGGVDQTPSTAGSDEKDREKDK 314
            :..:|....::||.||                                         .|...:| 
plant   244 VGEVHNCVDEIIRDKK-----------------------------------------RKPANQD- 266

  Fly   315 EKASPVAGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLDLMLESAQNGALITDTEIKEQVDTIMFE 379
                                               ||..::.:.:     :|..:::.|.:|:..
plant   267 -----------------------------------FLSRLIVAGE-----SDETVRDMVISIIMA 291

  Fly   380 GHDTTAAGSSFFLSLMGIHQDIQDRVLAELDSIFGDSQRPATFQDTLEMKYLERCLMETLRMYPP 444
            |.|||:|.::....|:..|::.:..:::|:.|:..:......::...::..|:.||.|.:|:|||
plant   292 GRDTTSAVATRLFWLITGHEETEHDLVSEIRSVKEEITGGFDYESLKKLSLLKACLCEVMRLYPP 356

  Fly   445 VPLIARELQEDLKLNSGNYVIPRGATVTVATVLLHRNPKVYANPNVFDPDNFLPERQANRH---- 505
            ||..::....|.:|..|. ::..|..||.....:.|..:::..    |.|.|.|.|.|..:    
plant   357 VPWDSKHALTDDRLPDGT-LVRAGDRVTYFPYGMGRMEELWGE----DWDEFKPNRWAESYDKTC 416

  Fly   506 --------YYAFVPFSAGPRSCVGRKYAMLKLKILLSTILRNYRVYSDLTES-DF--KLQADIIL 559
                    .:.|..|.||||.|:|.:.|.:::|.::::||..:.:....|:. ||  .|.|.:  
plant   417 CRVLKKVNPFKFPVFQAGPRVCLGEEMAYVQMKYIVASILDRFEIEPIPTDKPDFVPMLTAHM-- 479

  Fly   560 KREEGFRVRLQPR 572
              ..|.:||:..|
plant   480 --AGGMQVRVHRR 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 105/535 (20%)
CYP94B2NP_566155.1 CYP86A 65..483 CDD:410687 104/526 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.