DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g15 and Cyp6a23

DIOPT Version :9

Sequence 1:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster


Alignment Length:578 Identity:128/578 - (22%)
Similarity:235/578 - (40%) Gaps:111/578 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLPTLVLWYIYWRLSRAHLYRLAGRLPGPRGLPIVGHLFDVIGP----ASSVFR---TVIRKSA 77
            |.|..|::..:.:...|.|.|.....:|.....||.|::.|  .|    .:.:||   |..::|.
  Fly     5 LTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKD--WPKKRHIAMIFRDYYTKYKRSV 67

  Fly    78 -PFEHIAKMWIGPKLVVFIYDPRDVELLLSSHVYIDKASEYK---FFKPWLGDGL---LIS-TGQ 134
             ||......:....::.      |:||:  ..|.|...:.::   .|...:.|.|   |.| .||
  Fly    68 YPFAGFYFFFTRSAVIT------DLELV--KRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQ 124

  Fly   135 KWRSHRKLIAPTFHLNVLKS----FIELFNENSRNVVRKLRAEDGRTFDCHDYMSEATVEILLET 195
            |||..|..:.|||....:|:    .:::..|..:....|....:|:..:..|.::..|.:::...
  Fly   125 KWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNC 189

  Fly   196 AMGVSKKTQDKSGFEYAMAVMRMCDILHARHRSI--FLRNEFVFTLTRYYKEQGRLLNI--IHGL 256
            |.|::..:......|:.....|.  |:..|:..:  ||    :|...:..:.....||:  :...
  Fly   190 AFGLNCNSLQNPNAEFVTIGKRA--IIERRYGGLLDFL----IFGFPKLSRRLRLKLNVQDVEDF 248

  Fly   257 TTKVIRSKKAAFEQGTRGSLAQCELKAAALER-EREQNGGVDQTPSTAGSDEKDREKDKEKASPV 320
            .|.::|:   ..:...|.:..:.:...:.:|. |:||.|..:.                      
  Fly   249 YTSIVRN---TIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTED---------------------- 288

  Fly   321 AGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLDLMLESAQNGALITDTEIKEQVDTIMFEGHDTTA 385
             |||:                                         .||..|.......|.:|::
  Fly   289 -GLSF-----------------------------------------NEILAQAFIFFVAGFETSS 311

  Fly   386 AGSSFFLSLMGIHQDIQDRVLAELDSIFGDSQRPATFQDTLEMKYLERCLMETLRMYPPVPLIAR 450
            ....|.|..:.:.|||||::.||::::........|::...||||||:.:|||||.||.:..:.|
  Fly   312 TTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTR 376

  Fly   451 ELQEDLKLNSGNYVIPRGATVTVATVLLHRNPKVYANPNVFDPDNFLPERQANRHYYAFVPFSAG 515
            ..|.|.......|.|.:|.||.:..:.:|.:|::|..|..|.|:.|..|..|.|....::||..|
  Fly   377 MTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEG 441

  Fly   516 PRSCVGRKYAMLKLKILLSTILRNYRVYSDLTESDFKLQ---ADIILKREEGFRVRLQ 570
            ||:|:|.::.:::..:.|:.::|.|: :|..||:...::   ..|:|..|.|..::::
  Fly   442 PRNCIGLRFGLMQACVGLAYLIRGYK-FSVSTETQIPMKFVVKSILLSAENGIHLKVE 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 115/518 (22%)
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 121/542 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.