DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g15 and CYP4A22

DIOPT Version :9

Sequence 1:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:584 Identity:160/584 - (27%)
Similarity:268/584 - (45%) Gaps:93/584 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEVLKKDAALGSPSSVFY---FLLLPTLVLWYIYWRLSRAHLYRLAGRLPGPRGLPIVGHLFDVI 62
            :.||.....||..|.:..   .|:|..|::......|.|..|.:...:.|.|....:.||:.:. 
Human     3 VSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEF- 66

  Fly    63 GPASSVFRTVIRKSAPFEHIAKMWI-GPKLVVFIYDPRDVELLL-----SSHVYIDKASEYKFFK 121
             ......:.:..:...|......|| |.|:.|.:|||..::::|     .||      ..|||..
Human    67 -QHDQELQRIQERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSH------GSYKFLA 124

  Fly   122 PWLGDGLLISTGQKWRSHRKLIAPTFHLNVLKSFIELFNENSRNVVRK---LRAEDGRTFDCHDY 183
            |.:|.|||:..||.|..||:::.|.||.::||.::.|..::.|.::.|   |..:|. ..:...:
Human   125 PRIGYGLLLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDS-PLEVFQH 188

  Fly   184 MSEATVEILLETAMGVSKKTQ-DKSGFEYAMAVMRMCDILHARHRSIFLRNEFVFTLTRYYKEQG 247
            :|..|::.::::|.......| |::...|..|:..:..::....|:.|..|:.:::||...:...
Human   189 VSLMTLDTIMKSAFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWTH 253

  Fly   248 RLLNIIHGLTTKVIRSKKAAFEQGTRGSLAQCELKAAALEREREQNGGVDQTPSTAGSDEKDREK 312
            |...:.|..|.:||:.:||..:                                        :|.
Human   254 RACQLAHQHTDQVIQLRKAQLQ----------------------------------------KEG 278

  Fly   313 DKEKASPVAGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLD-LMLESAQNGALITDTEIKEQVDTI 376
            :.||                         |..|:.|.||| |:|...:||::::|.:::.:|||.
Human   279 ELEK-------------------------IKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTF 318

  Fly   377 MFEGHDTTAAGSSFFLSLMGIHQDIQDRVLAELDSIFGDSQRPATFQDTLEMKYLERCLMETLRM 441
            |||||||||:|.|:.|..:..|...|:|...|:..:.||. ...|:....:|.|...|:.|.||:
Human   319 MFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDG-ASITWNHLDQMPYTTMCIKEALRL 382

  Fly   442 YPPVPLIARELQEDLKLNSGNYVIPRGATVTVATVLLHRNPKVYANPNVFDPDNFLPERQANRHY 506
            |||||.|.|||...:....|. .:|:|..|.::...||.||||:.|..||||..|.|  .:.:|.
Human   383 YPPVPGIGRELSTPVTFPDGR-SLPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRFAP--GSAQHS 444

  Fly   507 YAFVPFSAGPRSCVGRKYAMLKLKILLSTILRNYRVYSDLTESDFKLQADIILKREEGFRVRLQ 570
            :||:|||.|.|:|:|:::||.:||:..:..|..:.:..|.|.....: |.::||.:.|..:||:
Human   445 HAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIPM-ARLVLKSKNGIHLRLR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 141/505 (28%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 147/531 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.