DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g15 and Cyp26a1

DIOPT Version :9

Sequence 1:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_569092.2 Gene:Cyp26a1 / 154985 RGDID:620161 Length:497 Species:Rattus norvegicus


Alignment Length:589 Identity:120/589 - (20%)
Similarity:192/589 - (32%) Gaps:190/589 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AALGSPSSVF---YFLLLPTLVLWYIYWRLSRAHLYRLAGRLPGPRGLPIVG------------- 56
            |.|.|....|   ..|.|..|.||.:|...||.....|. ..||..|.|..|             
  Rat     5 ALLASALCTFVLPLLLFLAALKLWDLYCVSSRDRSCALP-LPPGTMGFPFFGETLQMVLQRRKFL 68

  Fly    57 -------------HLFDVIGPASSVFRTVIRKSAPFEHIAKMWIGPKLVVFIYDPRDVELLLSSH 108
                         |||.         |..:|.... :::.::.:|...:|.::.|..|..:    
  Rat    69 QMKRRKYGFIYKTHLFG---------RPTVRVMGA-DNVRRILLGEHRLVSVHWPASVRTI---- 119

  Fly   109 VYIDKASEYKFFKPWLGDGLLISTGQKWRSHRKLIAPTFHLNVLKSFIELFNENSRNVVRKLRAE 173
                           ||.|.|.:........||           |..::.||..:          
  Rat   120 ---------------LGAGCLSNLHDSSHKQRK-----------KVIMQAFNREA---------- 148

  Fly   174 DGRTFDCHDYMSEATVEILLETAMGVSKKTQDKSGFEYAMAVMRMCDILHARHRSIFLRNEFVFT 238
                ..|:       |.::.|...|                                        
  Rat   149 ----LQCY-------VPVIAEEVSG---------------------------------------- 162

  Fly   239 LTRYYKEQGRLLNIIHGLTTKVIRSKKAAFEQ----GTRGSLAQCELKAAALEREREQNGGVDQT 299
                                        ..||    |.||.|...|:|............|.:..
  Rat   163 ----------------------------CLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPG 199

  Fly   300 PSTAGSDEKDREKDKEKAS----------PVAGLSYGQSAGLKDDLDVEDNDIGEKKRLA----- 349
            |:..|.||:...:..|:.:          |.:||..|..|.......:|:|...:.:||.     
  Rat   200 PAGGGEDEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGVKARNLIHARIEENIRAKIRRLQAAEPD 264

  Fly   350 -----FLDLMLE-SAQNGALITDTEIKEQVDTIMFEGHDTTAAGSSFFLSLMGIHQDIQDRVLAE 408
                 .|.|::| |.:.|..:....:|:....::|.||:|||:.::..::.:|::..:..:|..|
  Rat   265 AGCKDALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREE 329

  Fly   409 LDS---IFGDSQRPATFQDTLE-MKYLERCLMETLRMYPPVPLIARELQEDLKLNSGNYVIPRGA 469
            :.|   :...........:||| :||:...:.||||:.||||...|...:..:||  .|.||:|.
  Rat   330 IKSKGLLCKSHHEDKLDMETLEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELN--GYQIPKGW 392

  Fly   470 TVTVATVLLHRNPKVYANPNVFDPDNFLPERQANRHYYAFVPFSAGPRSCVGRKYAMLKLKILLS 534
            .|..:....|.....:.|...|:||.|......:...::|:||..|.|||||:::|.:.|||...
  Rat   393 NVIYSICDTHDVADSFTNKEEFNPDRFTSLHPEDTSRFSFIPFGGGLRSCVGKEFAKILLKIFTV 457

  Fly   535 TILR 538
            .:.|
  Rat   458 ELAR 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 107/547 (20%)
Cyp26a1NP_569092.2 p450 43..491 CDD:299894 107/551 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.