DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4g15 and Cyp26a1

DIOPT Version :9

Sequence 1:NP_572721.1 Gene:Cyp4g15 / 32093 FlyBaseID:FBgn0030304 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_031837.2 Gene:Cyp26a1 / 13082 MGIID:1096359 Length:497 Species:Mus musculus


Alignment Length:294 Identity:79/294 - (26%)
Similarity:135/294 - (45%) Gaps:27/294 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 GTRGSLAQCELKAAALEREREQNGGVDQTPSTAGSDEKDREKDKEKAS----------PVAGLSY 325
            |.||.|...|:|............|.:..|:..|.||:...:..|:.:          |.:||..
Mouse   171 GERGLLVYPEVKRLMFRIAMRILLGCEPGPAGGGEDEQQLVEAFEEMTRNLFSLPIDVPFSGLYR 235

  Fly   326 GQSAGLKDDLDVEDNDIGEKKRLA----------FLDLMLE-SAQNGALITDTEIKEQVDTIMFE 379
            |..|.......:|:|...:.:||.          .|.|::| |.:.|..:....:|:....::|.
Mouse   236 GVKARNLIHARIEENIRAKIRRLQATEPDGGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG 300

  Fly   380 GHDTTAAGSSFFLSLMGIHQDIQDRVLAELDS---IFGDSQRPATFQDTLE-MKYLERCLMETLR 440
            ||:|||:.::..::.:|::..:..:|..|:.|   :...:|......:||| :||....:.||||
Mouse   301 GHETTASAATSLITYLGLYPHVLQKVREEIKSKGLLCKSNQDNKLDMETLEQLKYTGCVIKETLR 365

  Fly   441 MYPPVPLIARELQEDLKLNSGNYVIPRGATVTVATVLLHRNPKVYANPNVFDPDNFLPERQANRH 505
            :.||||...|...:..:||  .|.||:|..|..:....|....::.|...|:||.|:.....:..
Mouse   366 LNPPVPGGFRVALKTFELN--GYQIPKGWNVIYSICDTHDVADIFTNKEEFNPDRFIVPHPEDAS 428

  Fly   506 YYAFVPFSAGPRSCVGRKYAMLKLKILLSTILRN 539
            .::|:||..|.|||||:::|.:.|||....:.|:
Mouse   429 RFSFIPFGGGLRSCVGKEFAKILLKIFTVELARH 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4g15NP_572721.1 p450 47..542 CDD:278495 79/294 (27%)
Cyp26a1NP_031837.2 p450 43..491 CDD:299894 79/294 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.