DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCNK6

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_004814.1 Gene:KCNK6 / 9424 HGNCID:6281 Length:313 Species:Homo sapiens


Alignment Length:334 Identity:88/334 - (26%)
Similarity:148/334 - (44%) Gaps:72/334 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDELLSFELA 131
            |.|.:.:.|..:|.|:...||.|.|    :.|:..::|.|.:.|.. ........||..:...||
Human     9 GALAAYAAYLVLGALLVARLEGPHE----ARLRAELETLRAQLLQR-SPCVAAPALDAFVERVLA 68

  Fly   132 KYEAAVQQAAEGGLLIVAD----KDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFC 192
                    |...|.:::|:    .:..:|  .|....|:||:||::||:|||...|:|..|:.|.
Human    69 --------AGRLGRVVLANASGSANASDP--AWDFASALFFASTLITTVGYGYTTPLTDAGKAFS 123

  Fly   193 ICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFIGKTW-----------FYAILAV 246
            |.|||:|:|.|:.::.    ..|..:|:...|:|     .:::...|           ..|:|.|
Human   124 IAFALLGVPTTMLLLT----ASAQRLSLLLTHVP-----LSWLSMRWGWDPRRAACWHLVALLGV 179

  Fly   247 GFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVP-KKPN------YMLLCTLYIL 304
             .:.|.....|.:....|:.|:|.|.||||||:::|||.||.|| :.|.      |.:|.|:|:.
Human   180 -VVTVCFLVPAVIFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTVYLF 243

  Fly   305 IGLALTSTIIELVRRQYATSWAKLQEL---------------------SGPMAETLRRLGETAGT 348
            :||.....:::..|  :.:....|.||                     .||..|:.::|..::.|
Human   244 LGLVAMVLVLQTFR--HVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHT 306

  Fly   349 GLDYTALQK 357
              ||.::.:
Human   307 --DYASIPR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 22/56 (39%)
Ion_trans <240..314 CDD:278921 29/80 (36%)
Ion_trans_2 <266..319 CDD:285168 23/59 (39%)
KCNK6NP_004814.1 Ion_trans_2 <91..146 CDD:285168 23/58 (40%)
Ion_trans_2 180..256 CDD:285168 26/75 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 288..313 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4331
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.