DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCNK5

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_003731.1 Gene:KCNK5 / 8645 HGNCID:6280 Length:499 Species:Homo sapiens


Alignment Length:393 Identity:103/393 - (26%)
Similarity:158/393 - (40%) Gaps:99/393 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LLVSLSI-YCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTI-----LNNTEVHNLDELL 126
            ||.|..| |..:|..||..||.|       |.|:..|.:..:.||.:     |..   ..||::|
Human     7 LLTSAIIFYLAIGAAIFEVLEEP-------HWKEAKKNYYTQKLHLLKEFPCLGQ---EGLDKIL 61

  Fly   127 SFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVF 191
            .        .|..||..|:.|..::.|    ..|:...|:.|::||:|||||||:.|.|..||:|
Human    62 E--------VVSDAAGQGVAITGNQTF----NNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLF 114

  Fly   192 CICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFIGKTWFYAILAVGFLGVYLAAG 256
            |:.:.|.|:|..||.|:..|:.|.......|:.:..:.........|.....:..|.| |:|...
Human   115 CVFYGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVL-VHLVIP 178

  Fly   257 AGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVP---KKPNYMLL----CTLYILIGLALTSTI- 313
            ..:.::.| .|.:.:|.|:.|||::||||||.|.   ...||..|    ..|:|.:|||..|.. 
Human   179 PFVFMVTE-GWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSLFV 242

  Fly   314 -------------IELVRRQYATSWAKLQELSGPMAETLRRLGETAGTGLDYTALQKVLTVSMPK 365
                         |:..||:...|:    |.|....:.|:..|.||..           .|::..
Human   243 NWKVSMFVEVHKAIKKRRRRRKESF----ESSPHSRKALQVKGSTASK-----------DVNIFS 292

  Fly   366 WNSKKNEHSPDIAALEAITNAILKEV-KEAQNNK----------------------PKVLQIVIY 407
            :.|||.|          ..|.::|:: |:|....                      |.::.:|:|
Human   293 FLSKKEE----------TYNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLVPLVVY 347

  Fly   408 ESS 410
            ..:
Human   348 SKN 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 25/56 (45%)
Ion_trans <240..314 CDD:278921 27/94 (29%)
Ion_trans_2 <266..319 CDD:285168 23/73 (32%)
KCNK5NP_003731.1 Ion_trans_2 <81..137 CDD:311712 25/55 (45%)
Ion_trans_2 171..243 CDD:311712 26/73 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..335 1/22 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..388
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..499
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I10032
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.