powered by:
Protein Alignment CG43155 and CTF3
DIOPT Version :9
Sequence 1: | NP_572720.2 |
Gene: | CG43155 / 32092 |
FlyBaseID: | FBgn0262685 |
Length: | 411 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013485.1 |
Gene: | CTF3 / 851097 |
SGDID: | S000004373 |
Length: | 733 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 34 |
Identity: | 12/34 - (35%) |
Similarity: | 18/34 - (52%) |
Gaps: | 0/34 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 377 IAALEAITNAILKEVKEAQNNKPKVLQIVIYESS 410
|.||..|...||:.::.|:|.|.|....:|.|.:
Yeast 636 IPALSYICIIILRRLETAENTKIKFTSGIINEET 669
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S12594 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.