DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG43155 and KCO3

DIOPT Version :9

Sequence 1:	NP_572720.2	Gene:	CG43155 / 32092	FlyBaseID:	FBgn0262685	Length:	411	Species:	Drosophila melanogaster
Sequence 2:	NP_001190480.1	Gene:	KCO3 / 834679	AraportID:	AT5G46360	Length:	260	Species:	Arabidopsis thaliana

Alignment Length:	49	Identity:	16/49 - (32%)
Similarity:	23/49 - (46%)	Gaps:	10/49 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   239 WFYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGD 287
            :|:.:...|||.|:.....|.|          |.|.|..:.:||:||||
plant   105 YFFVVTFCGFLIVHFVVKIGWL----------DSFCFSVMMVTTVGFGD 143

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG43155	NP_572720.2	Ion_trans_2	<157..214	CDD:285168
		Ion_trans	<240..314	CDD:278921	16/48 (33%)
		Ion_trans_2	<266..319	CDD:285168	9/22 (41%)
KCO3	NP_001190480.1	Ion_trans_2	104..176	CDD:285168	16/49 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1418
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D774951at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR11003
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X19
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	4.010