DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCO5

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_192093.1 Gene:KCO5 / 828091 AraportID:AT4G01840 Length:408 Species:Arabidopsis thaliana


Alignment Length:249 Identity:52/249 - (20%)
Similarity:102/249 - (40%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 DKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPF---TLTVIADW- 210
            ::|.....|...::.|::|....:.|||||:|.|:|...::|.:.|.|.|..|   .|:.:.:: 
plant   138 NRDHYSGIETHPVVDALYFCIVTMCTIGYGDIAPLTPWTKIFAVVFVLFGFGFLDILLSGVVNYV 202

  Fly   211 ----GRLFATAVSVFGKH-------MPTKPKFTNF-IGKTWFYAILAVGFLGVYLAAGAGLLLL- 262
                ..:..|.:.....|       ...|....:| .|:......:.:....|.|..|.|.|:| 
plant   203 LDLQESMILTGIQTRQHHQHHHHHRFSAKDYIIDFEKGRMRIRMKVCLALCVVVLCIGVGALVLH 267

  Fly   263 WEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIG-LALTSTIIELV------RRQ 320
            :.::..|.|..|...:::||:|:||...|.....|...:::|:. ||:....:.|.      |.:
plant   268 FVEELGFVDSVYLSVMSVTTVGYGDRAFKTLQGRLFAAVWLLVSTLAVARAFLYLAEARIDRRHR 332

  Fly   321 YATSWAKLQELS------------GPMAET------LRRLGETAGTGLDYTALQ 356
            .|...|..:|::            |.::::      |:.:|:.....:|...:|
plant   333 KAVKLALNREITVDDLLKADTYQHGFISKSEYIVLKLKEMGKITQKDIDQVVIQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 17/64 (27%)
Ion_trans <240..314 CDD:278921 19/75 (25%)
Ion_trans_2 <266..319 CDD:285168 14/59 (24%)
KCO5NP_192093.1 Ion_trans_2 122..204 CDD:285168 18/65 (28%)
Ion_trans_2 254..325 CDD:285168 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.