DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCO6

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_193550.1 Gene:KCO6 / 827541 AraportID:AT4G18160 Length:436 Species:Arabidopsis thaliana


Alignment Length:190 Identity:44/190 - (23%)
Similarity:85/190 - (44%) Gaps:21/190 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVI 207
            |.|:...::|.....:...::..::|....:.|||||:|.|.:...::|.|.|.|:|..|...::
plant   164 GVLIYWLNRDHYVVNQTHPVVDGLYFCIVTMCTIGYGDITPNSVVTKLFSIMFVLVGFGFIDILL 228

  Fly   208 ADWGRLFATAVSVFGKHMPTKPKFTNFIGKTWFYAI--------------LAVGFLGVYLAAGAG 258
            :.   :.:..:.:...:|....|..:...|...|.|              ||:|.:.:.:|.|.|
plant   229 SG---MVSYVLDLQESYMLDSAKRRDEPEKRRSYIIDVKKGRMRIRLKVALALGVVVLCIAVGVG 290

  Fly   259 LL-LLWEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIG-LALTSTIIEL 316
            :: .:.|..|  .|.||...:::||:|:||...|.....|...:::|:. ||:....:.|
plant   291 IMHFIEEIGW--LDSFYLSVMSVTTVGYGDRAFKTLPGRLFAAIWLLVSTLAVARAFLYL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301 17/70 (24%)
Ion_trans_2 <267..319 CDD:462301 15/51 (29%)
KCO6NP_193550.1 Ion_trans_2 156..237 CDD:462301 17/75 (23%)
Ion_trans_2 280..351 CDD:462301 19/71 (27%)

Return to query results.
Submit another query.