DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCO6

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_193550.1 Gene:KCO6 / 827541 AraportID:AT4G18160 Length:436 Species:Arabidopsis thaliana


Alignment Length:190 Identity:44/190 - (23%)
Similarity:85/190 - (44%) Gaps:21/190 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVI 207
            |.|:...::|.....:...::..::|....:.|||||:|.|.:...::|.|.|.|:|..|...::
plant   164 GVLIYWLNRDHYVVNQTHPVVDGLYFCIVTMCTIGYGDITPNSVVTKLFSIMFVLVGFGFIDILL 228

  Fly   208 ADWGRLFATAVSVFGKHMPTKPKFTNFIGKTWFYAI--------------LAVGFLGVYLAAGAG 258
            :.   :.:..:.:...:|....|..:...|...|.|              ||:|.:.:.:|.|.|
plant   229 SG---MVSYVLDLQESYMLDSAKRRDEPEKRRSYIIDVKKGRMRIRLKVALALGVVVLCIAVGVG 290

  Fly   259 LL-LLWEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIG-LALTSTIIEL 316
            :: .:.|..|  .|.||...:::||:|:||...|.....|...:::|:. ||:....:.|
plant   291 IMHFIEEIGW--LDSFYLSVMSVTTVGYGDRAFKTLPGRLFAAIWLLVSTLAVARAFLYL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 14/56 (25%)
Ion_trans <240..314 CDD:278921 23/89 (26%)
Ion_trans_2 <266..319 CDD:285168 15/52 (29%)
KCO6NP_193550.1 Ion_trans_2 156..237 CDD:400301 17/75 (23%)
Ion_trans_2 280..351 CDD:400301 19/71 (27%)
EF-hand_7 374..431 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.