DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and si:ch73-334d15.4

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001429287.1 Gene:si:ch73-334d15.4 / 796217 ZFINID:ZDB-GENE-091204-184 Length:430 Species:Danio rerio


Alignment Length:184 Identity:37/184 - (20%)
Similarity:71/184 - (38%) Gaps:49/184 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 CI----CFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFIGKTWFYAILAVGFLGVY 252
            ||    .|.|:...|.:.|:....|...|::.:    :|........|..|.|| ...:.....|
Zfish   283 CIRLLRVFKLMQHVFGVRVLTHTLRASLTSLCI----VPLLLSICTLIFGTMFY-FAELTHKDSY 342

  Fly   253 LAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIGLALTSTIIELV 317
            :::.:||           |||::..:|:||:|:||::|.......:..|..::|:.|....:.::
Zfish   343 ISSSSGL-----------DGFWWALVTLTTVGYGDMLPVTRQGKCVAFLCAMVGVLLIVLPVPII 396

  Fly   318 RRQYATSWAKLQELSGPMAETLRRLGETAGTGLDYTALQKVLTVSMPKWNSKKN 371
            ...:                            |.:::|.|. ..|||:.|.|::
Zfish   397 VNNF----------------------------LKFSSLVKT-KHSMPRMNEKRS 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301 7/25 (28%)
Ion_trans_2 <267..319 CDD:462301 13/51 (25%)
si:ch73-334d15.4NP_001429287.1 None

Return to query results.
Submit another query.