DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcnk16

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001102990.1 Gene:Kcnk16 / 688996 RGDID:1582911 Length:292 Species:Rattus norvegicus


Alignment Length:284 Identity:84/284 - (29%)
Similarity:131/284 - (46%) Gaps:57/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ACWQSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFL--HTIL 114
            :||....       :.||::...|..:|..||:.||:.||.:.    :|..:..:.|||  :|.|
  Rat     8 SCWGGQV-------LPLLLAYICYLLLGATIFQRLEKQAEAQS----RDQFQLEKLRFLENYTCL 61

  Fly   115 NNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYG 179
            :...:              |..||...|..:..|..|........|....:.||:.||:||||||
  Rat    62 DQQAL--------------EQFVQVILEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYG 112

  Fly   180 NIVPVTTGGRVFCICFALIGIPFTLTVIADWG---RLFATAVSVFGKHMPTKPKFTNFIGKTWFY 241
            |:.|.|..|:|||:.:||:|||..:..:...|   |...|.:..:..|    |:.:.        
  Rat   113 NLAPSTEAGQVFCVFYALMGIPLNVVFLNHLGTGLRAHLTTLDRWEDH----PRHSQ-------- 165

  Fly   242 AILAVGFLGVYLAAGAGLLLLWE-------DDWTFFDGFYFCFITMTTIGFGDLV----PKK--- 292
             :|.|..|.::|..|..::|::.       :.|:|.:||||.|||::||||||.|    |.|   
  Rat   166 -LLQVLGLALFLTLGTLVILIFPPMFFSHVEGWSFREGFYFAFITLSTIGFGDYVVGTDPSKHYI 229

  Fly   293 PNYMLLCTLYILIGLALTSTIIEL 316
            ..|..|..::||:|||..:.::.|
  Rat   230 AVYRSLAAIWILLGLAWLAVVLSL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 25/59 (42%)
Ion_trans <240..314 CDD:278921 31/87 (36%)
Ion_trans_2 <266..319 CDD:285168 26/58 (45%)
Kcnk16NP_001102990.1 Ion_trans_2 <92..148 CDD:285168 24/55 (44%)
Ion_trans_2 180..248 CDD:285168 26/67 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - otm44944
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.