DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcnd2

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_113918.2 Gene:Kcnd2 / 65180 RGDID:68393 Length:630 Species:Rattus norvegicus


Alignment Length:132 Identity:31/132 - (23%)
Similarity:58/132 - (43%) Gaps:21/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 FYFCFITMTTIGFGDLVPKK---PNYMLLCTLYILIGLALTSTII-----------ELVRRQYAT 323
            |::..:||||:|:||:|||.   ..:..:|:|..::.:||...:|           :...::.|.
  Rat   361 FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRRAQ 425

  Fly   324 SWAKLQELSGPMAETLRRLGETAGTGLDYTALQKVLTVSMPKWNSK-----KNEHSPDIAALEAI 383
            ..|:|..:....:.:.....::...||....||.  :...|.:.||     :.:|...:..||..
  Rat   426 KKARLARIRAAKSGSANAYMQSKRNGLLSNQLQS--SEDEPAFVSKSGSSFETQHHHLLHCLEKT 488

  Fly   384 TN 385
            ||
  Rat   489 TN 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301
Ion_trans_2 <267..319 CDD:462301 16/59 (27%)
Kcnd2NP_113918.2 Interaction with KCNIP1, KCNIP2, and other family members. /evidence=ECO:0000305|PubMed:14980206, ECO:0000305|PubMed:14980207 2..20
BTB_POZ 6..144 CDD:453885
Interaction with KCNIP1. /evidence=ECO:0000305|PubMed:14980207 71..90
Ion_trans 184..415 CDD:459842 16/53 (30%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 308..321
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 370..375 2/4 (50%)
DUF3399 470..546 CDD:463381 5/21 (24%)
Important for normal channel activation and inactivation, for interaction with KCNIP2, and probably other family members as well. /evidence=ECO:0000305|PubMed:16820361 474..630 5/17 (29%)
Required for dendritic targeting. /evidence=ECO:0000269|PubMed:12592409 474..489 3/14 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 600..623
PDZ-binding. /evidence=ECO:0000269|PubMed:11923279, ECO:0000269|PubMed:14559911 627..630
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.