DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCNK15

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_071753.2 Gene:KCNK15 / 60598 HGNCID:13814 Length:330 Species:Homo sapiens


Alignment Length:281 Identity:82/281 - (29%)
Similarity:116/281 - (41%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDELLSFELA 131
            ||::....|..||..:|..||..||..|...|.......|.:|                 .|...
Human    10 GLVLCTLCYLLVGAAVFDALESEAESGRQRLLVQKRGALRRKF-----------------GFSAE 57

  Fly   132 KYEAAVQQAAEGGLLIVADKDFPEPY---ERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCI 193
            .|....:.|.:.           ||:   .:|....:.:|:.||:|||.||:..|.|..|:|||:
Human    58 DYRELERLALQA-----------EPHRAGRQWKFPGSFYFAITVITTIEYGHAAPGTDSGKVFCM 111

  Fly   194 CFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFIGKTWFYA----ILAVGFL--GVY 252
            .:||:|||.||......|......|    :.:....|..  :|..|...    ::..|.|  ...
Human   112 FYALLGIPLTLVTFQSLGERLNAVV----RRLLLAAKCC--LGLRWTCVSTENLVVAGLLACAAT 170

  Fly   253 LAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLV--------PKKPNYMLLCTLYILIGLAL 309
            ||.||.....:| .||||..:|:||||:|||||||.|        .:|..|:....||||:||.:
Human   171 LALGAVAFSHFE-GWTFFHAYYYCFITLTTIGFGDFVALQSGEALQRKLPYVAFSFLYILLGLTV 234

  Fly   310 TSTIIELVRRQYATSWAKLQE 330
            ....:.||..::..:.|...|
Human   235 IGAFLNLVVLRFLVASADWPE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 23/59 (39%)
Ion_trans <240..314 CDD:278921 32/87 (37%)
Ion_trans_2 <266..319 CDD:285168 27/60 (45%)
KCNK15NP_071753.2 Ion_trans_2 <77..132 CDD:285168 23/54 (43%)
Ion_trans_2 176..243 CDD:285168 27/67 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..276 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.