DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcna2b

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001104640.1 Gene:kcna2b / 562853 ZFINID:ZDB-GENE-080204-89 Length:495 Species:Danio rerio


Alignment Length:102 Identity:28/102 - (27%)
Similarity:48/102 - (47%) Gaps:27/102 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 FELAKYEAAVQ--------QAAEGGLLI---------------VADKDFPEPYERWSILQAVFFS 169
            |:|:::...:|        ...|.||||               .|:.|.|:. :..||..|.:::
Zfish   301 FKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPDS-QFVSIPDAFWWA 364

  Fly   170 STVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTV 206
            ...:||:|||::||.|.||::.....|:.|:   ||:
Zfish   365 VVSMTTVGYGDMVPTTIGGKIVGSLCAIAGV---LTI 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301 24/79 (30%)
Ion_trans_2 <267..319 CDD:462301
kcna2bNP_001104640.1 BTB_POZ 33..159 CDD:453885
Ion_trans 162..416 CDD:459842 28/102 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.