DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk18

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001177236.2 Gene:kcnk18 / 561821 ZFINID:ZDB-GENE-100405-2 Length:391 Species:Danio rerio


Alignment Length:384 Identity:93/384 - (24%)
Similarity:146/384 - (38%) Gaps:139/384 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GRRSTACWQSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLH 111
            ||.||..|:      ...|:.|::||.:|..:|.|:||.:|..........:..||    ::.:.
Zfish    11 GRCSTLFWR------LFPHVFLILSLVLYAVLGALVFRAIEYTNPRNESEEILSIV----QKVME 65

  Fly   112 TILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYER---WSILQAVFFSSTVL 173
            .:.|:|:......|::  .|||              :.| |:....||   |:...::||..||.
Zfish    66 IVQNHTDASEQKHLIN--KAKY--------------ILD-DYCYEKERDHGWTFFASLFFCCTVF 113

  Fly   174 TTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVS------------------- 219
            ||:|||.|.|:|:.|:|.|:.:|::|||..|.||:|.|.|.|..:|                   
Zfish   114 TTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRRWIGHQSW 178

  Fly   220 ----------------------------------------------------------VFGK--- 223
                                                                      :|.:   
Zfish   179 RLQSHEKTSALPQAQADTDGTYKFNQDVVVLETTNNQQVIQTRSSIRRGSFQLRNNKEIFDRIIV 243

  Fly   224 --------------------HMPT-KPKFTNFIGKTW------FYAILAVGFLGVYLAAGAGLLL 261
                                .:|| |.:..|.||:..      ...||.:.|  .|:...:.:|.
Zfish   244 RESFRIKGTLSKSCSCPELDRVPTPKDELFNDIGQEMEQLDVPLLVILLMVF--AYMVICSQILK 306

  Fly   262 LWEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQ 320
            .||......|.|||.|||:|||||||:||:.|.:.::..|:|:.|:|:.|...:|.:.|
Zfish   307 CWEKQMDHSDAFYFTFITLTTIGFGDIVPEHPKFFMVTFLFIITGMAIMSMAFKLGQSQ 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 27/59 (46%)
Ion_trans <240..314 CDD:278921 29/73 (40%)
Ion_trans_2 <266..319 CDD:285168 23/52 (44%)
kcnk18NP_001177236.2 Ion_trans_2 <99..154 CDD:285168 25/54 (46%)
Ion_trans_2 292..367 CDD:285168 29/76 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590189
Domainoid 1 1.000 63 1.000 Domainoid score I10236
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.