DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk7

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001373286.1 Gene:kcnk7 / 557297 ZFINID:ZDB-GENE-110304-2 Length:362 Species:Danio rerio


Alignment Length:323 Identity:98/323 - (30%)
Similarity:145/323 - (44%) Gaps:69/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IGLLVSLSIYCGVGGLIFRHLERPAE---VERLSHLKDIVKTHRERFLHTILNN--TEVHNLDEL 125
            |.|:|:..::..:|.::...||:|.|   |:.:..||       .|||   .:|  .|..:||.|
Zfish    18 IFLMVAYGLFIVMGAVVLMVLEQPEENLLVQEVRELK-------ARFL---ADNPCVEERSLDGL 72

  Fly   126 LSFELAKYEAAVQQAAEGGLLIVADKDFPEPYE-RWSILQAVFFSSTVLTTIGYGNIVPVTTGGR 189
            |...|:       .:..|...:.||.|     | .:....::||..|.|||.|||..||::..||
Zfish    73 LMDVLS-------ASKRGVAALQADSD-----ECNFDFTSSLFFVITFLTTTGYGTTVPLSDEGR 125

  Fly   190 VFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFIGKTWF-YAILAVGFLGVYL 253
            |||:.:.|:|||.|:.:::.........|:    |.|.: ....|.|.:.. .|:|....||...
Zfish   126 VFCVVYCLVGIPLTMLLLSCLTHALLPRVT----HTPIQ-NLQLFWGLSRSNAALLHCSILGFCT 185

  Fly   254 AA-----GAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVPKK-------PNYMLLCTLYILIG 306
            ||     .|..|.|.|||||:.:..|||||:::|.|.||.:|.|       .....:.:.|:|:|
Zfish   186 AALFFLLPAAALCLLEDDWTYLESLYFCFISLSTTGLGDYLPGKIQNQAVRQGLEFVTSCYLLLG 250

  Fly   307 LALTSTIIELVRRQYATSW------AKLQELSGPMAETLRRLGETAGTGLDYTALQKVLTVSM 363
            |.:...::|       :.|      |.|:..|||      ||.|..|..||    :.|||..|
Zfish   251 LIVLLVVLE-------SFWELQQFQAVLRFFSGP------RLSELNGLSLD----ELVLTGDM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 22/57 (39%)
Ion_trans <240..314 CDD:278921 29/86 (34%)
Ion_trans_2 <266..319 CDD:285168 19/59 (32%)
kcnk7NP_001373286.1 Ion_trans_2 <95..150 CDD:400301 21/54 (39%)
Ion_trans_2 <203..>227 CDD:400301 12/23 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.